Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PFS0

Protein Details
Accession A0A137PFS0   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-45LCHWDLPKKVKNKLKFPHEPERPNKQYIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, cyto_nucl 11.333, mito_nucl 9.166, cyto 7, mito 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR014756  Ig_E-set  
IPR005066  MoCF_OxRdtse_dimer  
IPR008335  Mopterin_OxRdtase_euk  
IPR000572  OxRdtase_Mopterin-bd_dom  
IPR036374  OxRdtase_Mopterin-bd_sf  
Gene Ontology GO:0030151  F:molybdenum ion binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF03404  Mo-co_dimer  
PF00174  Oxidored_molyb  
Amino Acid Sequences MSSTSRVDQSIYEDGDVLCHWDLPKKVKNKLKFPHEPERPNKQYIVRGECPFNAEPPLRQLVEEYITSKDVFFKRNHGPIPLIDENTHKVSVCGLVPKPFDLSMDAIKNNYSKLRILAALQCAGNRRNGLDKVKTVKGVIWGPGTIANSYWAGAPLREILIEAGLSPNGDGWMGKDFHIWMESYGPCEEDKVYGSSIPLETAMDPCKDVILAYEMNDEIMSRDHGFPVRMICPGIIGARSVKYLAKIEVREKESPAFYQQRDYKILPPEANDQNLEEYWDRCESIQEMNVQSVICTPSEQNPLTDSNIVKGYAISGGGRKIIRVEVSLDMGETWLIAKLHQEKTGHGYWSWCLWQVEVKSLKNVSKIICRAWDSSSNTQPCEPIWNYRGVMNNSWDIVQLMQNPKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.21
4 0.19
5 0.13
6 0.13
7 0.14
8 0.18
9 0.24
10 0.31
11 0.39
12 0.44
13 0.53
14 0.61
15 0.69
16 0.74
17 0.79
18 0.81
19 0.84
20 0.84
21 0.85
22 0.86
23 0.86
24 0.84
25 0.86
26 0.81
27 0.75
28 0.72
29 0.66
30 0.64
31 0.62
32 0.63
33 0.59
34 0.57
35 0.56
36 0.52
37 0.53
38 0.46
39 0.39
40 0.36
41 0.31
42 0.29
43 0.3
44 0.34
45 0.28
46 0.28
47 0.27
48 0.24
49 0.25
50 0.25
51 0.22
52 0.18
53 0.19
54 0.2
55 0.18
56 0.22
57 0.23
58 0.26
59 0.26
60 0.31
61 0.38
62 0.45
63 0.47
64 0.43
65 0.42
66 0.39
67 0.46
68 0.42
69 0.37
70 0.3
71 0.31
72 0.31
73 0.32
74 0.31
75 0.22
76 0.18
77 0.17
78 0.18
79 0.17
80 0.2
81 0.18
82 0.23
83 0.24
84 0.25
85 0.26
86 0.23
87 0.22
88 0.18
89 0.19
90 0.19
91 0.22
92 0.21
93 0.2
94 0.21
95 0.21
96 0.21
97 0.21
98 0.18
99 0.16
100 0.17
101 0.19
102 0.18
103 0.2
104 0.22
105 0.22
106 0.23
107 0.22
108 0.22
109 0.23
110 0.23
111 0.23
112 0.2
113 0.18
114 0.22
115 0.27
116 0.31
117 0.32
118 0.36
119 0.39
120 0.41
121 0.41
122 0.35
123 0.32
124 0.31
125 0.29
126 0.26
127 0.21
128 0.18
129 0.18
130 0.2
131 0.19
132 0.14
133 0.12
134 0.11
135 0.1
136 0.1
137 0.1
138 0.09
139 0.08
140 0.08
141 0.08
142 0.08
143 0.08
144 0.07
145 0.07
146 0.06
147 0.06
148 0.06
149 0.05
150 0.05
151 0.04
152 0.04
153 0.04
154 0.04
155 0.04
156 0.04
157 0.04
158 0.04
159 0.08
160 0.09
161 0.09
162 0.1
163 0.1
164 0.1
165 0.11
166 0.11
167 0.07
168 0.1
169 0.1
170 0.11
171 0.11
172 0.12
173 0.11
174 0.11
175 0.11
176 0.08
177 0.1
178 0.09
179 0.09
180 0.09
181 0.09
182 0.09
183 0.09
184 0.08
185 0.07
186 0.06
187 0.06
188 0.07
189 0.09
190 0.08
191 0.08
192 0.08
193 0.08
194 0.07
195 0.07
196 0.06
197 0.07
198 0.07
199 0.07
200 0.08
201 0.08
202 0.08
203 0.08
204 0.08
205 0.05
206 0.06
207 0.07
208 0.07
209 0.08
210 0.09
211 0.1
212 0.11
213 0.11
214 0.14
215 0.13
216 0.12
217 0.12
218 0.11
219 0.1
220 0.11
221 0.1
222 0.08
223 0.07
224 0.08
225 0.08
226 0.09
227 0.09
228 0.09
229 0.11
230 0.12
231 0.14
232 0.18
233 0.2
234 0.24
235 0.3
236 0.34
237 0.34
238 0.34
239 0.35
240 0.31
241 0.3
242 0.32
243 0.31
244 0.27
245 0.33
246 0.36
247 0.38
248 0.41
249 0.42
250 0.41
251 0.41
252 0.44
253 0.37
254 0.36
255 0.38
256 0.37
257 0.37
258 0.31
259 0.26
260 0.23
261 0.22
262 0.22
263 0.16
264 0.14
265 0.15
266 0.15
267 0.15
268 0.13
269 0.14
270 0.13
271 0.15
272 0.17
273 0.19
274 0.18
275 0.18
276 0.19
277 0.18
278 0.16
279 0.15
280 0.14
281 0.1
282 0.1
283 0.11
284 0.15
285 0.22
286 0.23
287 0.21
288 0.23
289 0.25
290 0.26
291 0.28
292 0.23
293 0.19
294 0.2
295 0.2
296 0.17
297 0.15
298 0.13
299 0.11
300 0.11
301 0.09
302 0.09
303 0.1
304 0.14
305 0.14
306 0.14
307 0.15
308 0.17
309 0.17
310 0.16
311 0.18
312 0.16
313 0.18
314 0.18
315 0.16
316 0.14
317 0.13
318 0.11
319 0.08
320 0.07
321 0.07
322 0.07
323 0.07
324 0.13
325 0.2
326 0.24
327 0.29
328 0.29
329 0.29
330 0.35
331 0.4
332 0.37
333 0.3
334 0.29
335 0.26
336 0.29
337 0.29
338 0.27
339 0.23
340 0.21
341 0.26
342 0.25
343 0.33
344 0.35
345 0.35
346 0.36
347 0.4
348 0.43
349 0.41
350 0.43
351 0.39
352 0.41
353 0.43
354 0.42
355 0.44
356 0.45
357 0.43
358 0.44
359 0.49
360 0.47
361 0.51
362 0.56
363 0.54
364 0.52
365 0.51
366 0.47
367 0.4
368 0.41
369 0.35
370 0.35
371 0.34
372 0.38
373 0.37
374 0.4
375 0.47
376 0.43
377 0.46
378 0.41
379 0.42
380 0.36
381 0.36
382 0.33
383 0.25
384 0.22
385 0.21
386 0.24