Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P9V7

Protein Details
Accession A0A137P9V7    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-23MPLLTLKKLKKNVNKESRKIPIPHydrophilic
NLS Segment(s)
PositionSequence
8-27KLKKNVNKESRKIPIPPHRL
Subcellular Location(s) mito 12, cyto 9.5, cyto_nucl 7.5, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR041174  KH_8  
IPR004087  KH_dom  
IPR036612  KH_dom_type_1_sf  
Gene Ontology GO:0005730  C:nucleolus  
GO:0003723  F:RNA binding  
GO:0051082  F:unfolded protein binding  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0043248  P:proteasome assembly  
Pfam View protein in Pfam  
PF17903  KH_8  
CDD cd22391  KH-I_PNO1_rpt1  
cd22392  KH-I_PNO1_rpt2  
Amino Acid Sequences MPLLTLKKLKKNVNKESRKIPIPPHRLAPLKKGWMSIYSPLVEHLKLEVRMNLRSKSVEIRTCKDTTDNGALQKGADFVKAIALGFDIPDAVALLRLDELYLDSFEIKDVKTLHGDHLARAIGRIAGKDGKTKFTIENTTKTRIVLADTKIHILGSFQNIRLAKDAVCSLILGSPPGKVYATLRSVAARMKERF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.83
3 0.84
4 0.83
5 0.78
6 0.73
7 0.72
8 0.72
9 0.7
10 0.67
11 0.63
12 0.62
13 0.65
14 0.62
15 0.6
16 0.58
17 0.57
18 0.55
19 0.52
20 0.46
21 0.42
22 0.42
23 0.39
24 0.34
25 0.26
26 0.25
27 0.25
28 0.25
29 0.21
30 0.18
31 0.16
32 0.17
33 0.18
34 0.19
35 0.21
36 0.21
37 0.27
38 0.31
39 0.3
40 0.27
41 0.27
42 0.27
43 0.3
44 0.33
45 0.35
46 0.35
47 0.38
48 0.41
49 0.4
50 0.39
51 0.35
52 0.3
53 0.28
54 0.3
55 0.28
56 0.24
57 0.24
58 0.23
59 0.21
60 0.2
61 0.17
62 0.11
63 0.09
64 0.07
65 0.06
66 0.08
67 0.08
68 0.07
69 0.06
70 0.05
71 0.05
72 0.05
73 0.05
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.03
82 0.04
83 0.04
84 0.04
85 0.03
86 0.04
87 0.04
88 0.04
89 0.04
90 0.04
91 0.04
92 0.05
93 0.06
94 0.05
95 0.07
96 0.08
97 0.09
98 0.12
99 0.13
100 0.14
101 0.21
102 0.21
103 0.19
104 0.2
105 0.2
106 0.17
107 0.16
108 0.15
109 0.1
110 0.1
111 0.1
112 0.1
113 0.13
114 0.14
115 0.2
116 0.21
117 0.23
118 0.24
119 0.26
120 0.26
121 0.26
122 0.34
123 0.31
124 0.38
125 0.39
126 0.43
127 0.41
128 0.39
129 0.36
130 0.28
131 0.28
132 0.25
133 0.24
134 0.26
135 0.26
136 0.27
137 0.26
138 0.26
139 0.22
140 0.17
141 0.17
142 0.18
143 0.2
144 0.19
145 0.25
146 0.26
147 0.27
148 0.29
149 0.27
150 0.2
151 0.2
152 0.2
153 0.16
154 0.15
155 0.14
156 0.12
157 0.13
158 0.13
159 0.12
160 0.12
161 0.12
162 0.12
163 0.14
164 0.13
165 0.12
166 0.15
167 0.2
168 0.23
169 0.23
170 0.24
171 0.24
172 0.26
173 0.29
174 0.33