Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NW58

Protein Details
Accession A0A137NW58    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
79-100SSLKKLKCVKFHKVFNHKISRGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, cyto_nucl 13, cyto 7, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR032675  LRR_dom_sf  
Amino Acid Sequences MHPVSILNYYSNIPERRTKFEEIIRDMRRCIFNCNIIVKEIHIRSDLPQYFFIELLDLFKDIENITITENIKLPLSTLSSLKKLKCVKFHKVFNHKISRGTIHSLKAVFKKAETLQIHGDWNHLYHNPTIFKIDSTFTNLTTLTIHNPEILSSFQVHLPALVNVEFSKMLKLHNIEHNNVVEFFDINLKLKKLSIPECMLSDQVIQSIFKLNNLKYLKVDNSVNQRILRELNGIENRTIEHLEITDYFCYEDLKLFFNFCINLKIVEISQFHTNSNNITELITRQLIKLLIINPISECYSFPNLPPSLIEHFSVIKFNDWKQAFEFKKTLSTLHDWKFREDYPDNSRNYCITRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.4
3 0.47
4 0.52
5 0.53
6 0.53
7 0.56
8 0.62
9 0.6
10 0.66
11 0.65
12 0.61
13 0.58
14 0.58
15 0.58
16 0.5
17 0.49
18 0.45
19 0.45
20 0.48
21 0.51
22 0.45
23 0.4
24 0.4
25 0.35
26 0.37
27 0.32
28 0.29
29 0.25
30 0.25
31 0.25
32 0.35
33 0.37
34 0.31
35 0.32
36 0.32
37 0.32
38 0.31
39 0.28
40 0.19
41 0.15
42 0.14
43 0.12
44 0.1
45 0.1
46 0.1
47 0.11
48 0.09
49 0.11
50 0.1
51 0.1
52 0.11
53 0.16
54 0.17
55 0.17
56 0.18
57 0.17
58 0.17
59 0.16
60 0.15
61 0.12
62 0.14
63 0.14
64 0.16
65 0.19
66 0.25
67 0.3
68 0.3
69 0.36
70 0.42
71 0.45
72 0.52
73 0.57
74 0.61
75 0.65
76 0.73
77 0.76
78 0.78
79 0.81
80 0.8
81 0.83
82 0.74
83 0.69
84 0.63
85 0.57
86 0.5
87 0.47
88 0.42
89 0.34
90 0.35
91 0.33
92 0.34
93 0.34
94 0.35
95 0.29
96 0.26
97 0.29
98 0.27
99 0.34
100 0.31
101 0.3
102 0.29
103 0.3
104 0.32
105 0.27
106 0.27
107 0.18
108 0.17
109 0.16
110 0.14
111 0.14
112 0.14
113 0.18
114 0.18
115 0.18
116 0.2
117 0.18
118 0.17
119 0.17
120 0.17
121 0.13
122 0.19
123 0.19
124 0.16
125 0.17
126 0.17
127 0.16
128 0.16
129 0.15
130 0.11
131 0.12
132 0.12
133 0.11
134 0.11
135 0.11
136 0.11
137 0.11
138 0.09
139 0.08
140 0.09
141 0.09
142 0.1
143 0.09
144 0.09
145 0.09
146 0.08
147 0.08
148 0.07
149 0.07
150 0.06
151 0.08
152 0.07
153 0.07
154 0.08
155 0.07
156 0.08
157 0.1
158 0.12
159 0.14
160 0.22
161 0.24
162 0.24
163 0.26
164 0.26
165 0.24
166 0.23
167 0.2
168 0.12
169 0.09
170 0.09
171 0.09
172 0.09
173 0.1
174 0.11
175 0.11
176 0.11
177 0.11
178 0.13
179 0.15
180 0.17
181 0.21
182 0.22
183 0.22
184 0.24
185 0.24
186 0.22
187 0.18
188 0.16
189 0.11
190 0.09
191 0.09
192 0.07
193 0.07
194 0.11
195 0.11
196 0.14
197 0.18
198 0.17
199 0.25
200 0.27
201 0.27
202 0.24
203 0.28
204 0.26
205 0.26
206 0.27
207 0.23
208 0.31
209 0.34
210 0.35
211 0.33
212 0.31
213 0.3
214 0.29
215 0.26
216 0.19
217 0.16
218 0.2
219 0.23
220 0.24
221 0.22
222 0.21
223 0.21
224 0.2
225 0.2
226 0.13
227 0.09
228 0.08
229 0.09
230 0.1
231 0.12
232 0.1
233 0.1
234 0.1
235 0.1
236 0.11
237 0.09
238 0.12
239 0.11
240 0.13
241 0.14
242 0.14
243 0.14
244 0.15
245 0.16
246 0.13
247 0.16
248 0.14
249 0.14
250 0.14
251 0.15
252 0.13
253 0.17
254 0.17
255 0.16
256 0.2
257 0.21
258 0.21
259 0.22
260 0.23
261 0.2
262 0.21
263 0.2
264 0.14
265 0.14
266 0.15
267 0.14
268 0.17
269 0.17
270 0.16
271 0.15
272 0.17
273 0.17
274 0.16
275 0.19
276 0.17
277 0.2
278 0.2
279 0.2
280 0.18
281 0.2
282 0.21
283 0.17
284 0.16
285 0.16
286 0.21
287 0.21
288 0.22
289 0.28
290 0.26
291 0.27
292 0.27
293 0.27
294 0.26
295 0.27
296 0.27
297 0.21
298 0.23
299 0.23
300 0.26
301 0.22
302 0.23
303 0.24
304 0.25
305 0.33
306 0.32
307 0.33
308 0.34
309 0.43
310 0.4
311 0.43
312 0.46
313 0.38
314 0.44
315 0.43
316 0.41
317 0.37
318 0.41
319 0.43
320 0.47
321 0.54
322 0.49
323 0.53
324 0.55
325 0.51
326 0.53
327 0.48
328 0.48
329 0.5
330 0.56
331 0.54
332 0.52
333 0.52
334 0.48