Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P6Z5

Protein Details
Accession A0A137P6Z5    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
147-168SKAKGKAKGKGKGKAKAKKEEDBasic
NLS Segment(s)
PositionSequence
140-165KRKDGSGSKAKGKAKGKGKGKAKAKK
Subcellular Location(s) cyto 13.5, cyto_nucl 11, nucl 7.5, extr 2, mito 1, pero 1, E.R. 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR044609  FKBP2/11  
IPR046357  PPIase_dom_sf  
IPR001179  PPIase_FKBP_dom  
Gene Ontology GO:0016020  C:membrane  
GO:0005528  F:FK506 binding  
GO:0003755  F:peptidyl-prolyl cis-trans isomerase activity  
GO:0061077  P:chaperone-mediated protein folding  
GO:0000413  P:protein peptidyl-prolyl isomerization  
Pfam View protein in Pfam  
PF00254  FKBP_C  
PROSITE View protein in PROSITE  
PS50059  FKBP_PPIASE  
Amino Acid Sequences MKLIYLLSILGLALAKEDESADEGVKPLNKLGIEVTYSVPQEECDYRTDEGDNISVHYTGTLLNGGKKFDSSLDRGEPLDFPLGKGAVIEGWDLGLRNMCVGEKRILKIPSWMAYGETGFGSLIPPNSDLEFSVELMDIKRKDGSGSKAKGKAKGKGKGKAKAKKEEDADAGGNEEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.06
3 0.06
4 0.06
5 0.06
6 0.08
7 0.09
8 0.09
9 0.1
10 0.1
11 0.13
12 0.15
13 0.15
14 0.13
15 0.16
16 0.15
17 0.15
18 0.16
19 0.16
20 0.15
21 0.16
22 0.17
23 0.17
24 0.17
25 0.17
26 0.15
27 0.13
28 0.16
29 0.16
30 0.16
31 0.14
32 0.17
33 0.18
34 0.19
35 0.19
36 0.16
37 0.15
38 0.16
39 0.14
40 0.12
41 0.12
42 0.11
43 0.1
44 0.09
45 0.08
46 0.06
47 0.07
48 0.08
49 0.07
50 0.11
51 0.12
52 0.13
53 0.13
54 0.13
55 0.13
56 0.13
57 0.16
58 0.15
59 0.17
60 0.18
61 0.19
62 0.2
63 0.2
64 0.18
65 0.16
66 0.17
67 0.13
68 0.12
69 0.11
70 0.11
71 0.1
72 0.1
73 0.08
74 0.04
75 0.05
76 0.05
77 0.03
78 0.04
79 0.04
80 0.04
81 0.04
82 0.05
83 0.04
84 0.04
85 0.05
86 0.05
87 0.06
88 0.08
89 0.13
90 0.15
91 0.16
92 0.22
93 0.23
94 0.24
95 0.27
96 0.27
97 0.25
98 0.24
99 0.23
100 0.17
101 0.17
102 0.17
103 0.13
104 0.1
105 0.08
106 0.06
107 0.06
108 0.06
109 0.06
110 0.07
111 0.07
112 0.08
113 0.09
114 0.1
115 0.1
116 0.1
117 0.12
118 0.13
119 0.12
120 0.12
121 0.11
122 0.11
123 0.12
124 0.17
125 0.14
126 0.15
127 0.16
128 0.15
129 0.18
130 0.23
131 0.29
132 0.34
133 0.39
134 0.46
135 0.52
136 0.56
137 0.62
138 0.62
139 0.64
140 0.63
141 0.67
142 0.67
143 0.69
144 0.74
145 0.75
146 0.79
147 0.8
148 0.79
149 0.81
150 0.78
151 0.77
152 0.72
153 0.69
154 0.62
155 0.58
156 0.51
157 0.4