Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NXW8

Protein Details
Accession A0A137NXW8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
108-128KIMVKNDWLKQQKQKQKIQKIHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 24, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036787  T_IF-3_N_sf  
IPR001288  Translation_initiation_fac_3  
IPR019814  Translation_initiation_fac_3_N  
Gene Ontology GO:0003743  F:translation initiation factor activity  
Pfam View protein in Pfam  
PF05198  IF3_N  
Amino Acid Sequences MNYFRLITTPAFNQIKRVSTRQFSSFGPILQLASKPSGASTIPGKPEQPNRNIKGPVINDGIIAKVIKLINEEGELVGTQKTSDVLKDLDTKVHVLVQVTNDRPPTCKIMVKNDWLKQQKQKQKIQKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.42
3 0.43
4 0.47
5 0.45
6 0.46
7 0.5
8 0.47
9 0.46
10 0.4
11 0.42
12 0.38
13 0.31
14 0.27
15 0.23
16 0.21
17 0.19
18 0.19
19 0.14
20 0.14
21 0.14
22 0.11
23 0.11
24 0.12
25 0.11
26 0.12
27 0.13
28 0.16
29 0.19
30 0.2
31 0.22
32 0.24
33 0.34
34 0.38
35 0.42
36 0.47
37 0.48
38 0.53
39 0.52
40 0.48
41 0.46
42 0.41
43 0.37
44 0.3
45 0.26
46 0.2
47 0.19
48 0.19
49 0.12
50 0.11
51 0.07
52 0.07
53 0.07
54 0.07
55 0.08
56 0.08
57 0.08
58 0.09
59 0.09
60 0.06
61 0.07
62 0.06
63 0.06
64 0.06
65 0.05
66 0.04
67 0.04
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.1
74 0.15
75 0.16
76 0.17
77 0.18
78 0.18
79 0.17
80 0.18
81 0.17
82 0.13
83 0.14
84 0.16
85 0.22
86 0.23
87 0.25
88 0.27
89 0.27
90 0.28
91 0.29
92 0.31
93 0.28
94 0.32
95 0.33
96 0.4
97 0.46
98 0.53
99 0.59
100 0.59
101 0.65
102 0.66
103 0.69
104 0.7
105 0.74
106 0.74
107 0.75
108 0.8