FuNGI

A0A137P3Z8

Protein Details

Accession

A0A137P3Z8

Localization Confidence

High

Confidence Score

21.7

NoLS Segment(s)

Position	Sequence	Protein Nature
13-33	SSSNNNNKHRSQKGNNSSNAS	Hydrophilic
223-246	EDGQKSKSGKKSKKEKAAKQAQTT	Hydrophilic
253-273	TKLSKAAKLKKKKAKASEEKG	Basic
462-486	PGTETKFKSKAKPKISKPKGPSFGS	Hydrophilic
526-547	TSGEPRAPKPPRNREANPKFGG	Hydrophilic
552-579	SEEGGDAKSKPKKYRPKPNKPAAGTGPA	Hydrophilic

NLS Segment(s)

Position	Sequence
202-241	KAKKMEKASKNKFKSSAALKGEDGQKSKSGKKSKKEKAAK
254-279	KLSKAAKLKKKKAKASEEKGADGKSP
468-481	FKSKAKPKISKPKG
530-573	PRAPKPPRNREANPKFGGKPGQSEEGGDAKSKPKKYRPKPNKPA

Subcellular Location(s)

nucl 17, cyto_nucl 12, mito 7

Family & Domain DBs

InterPro	View protein in InterPro IPR012677 Nucleotide-bd_a/b_plait_sf IPR035979 RBD_domain_sf IPR039722 Upf3 IPR005120 UPF3_dom
Gene Ontology	GO:0003676 F:nucleic acid binding GO:0000184 P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Pfam	View protein in Pfam PF03467 Smg4_UPF3
CDD	cd12455 RRM_like_Smg4_UPF3

Amino Acid Sequences

MSTTVEVNTPSISSSNNNNKHRSQKGNNSSNASNAPLNPKLKLTIRQLPPSLPEEVFKSSIKPYLTDEKDIVDQKFIPGKVSKKVLTPSKPSRAVIKFETIQKLINFKNLFKNHVYVDQQGVEFKIQIIFSPIQQNPKENNIQDAKLNTLESDPEFIKFCSKLHSEGEKEKSNNSNEILLGAQQQSTNEANKKSTPLLEYLKAKKMEKASKNKFKSSAALKGEDGQKSKSGKKSKKEKAAKQAQTTDEASSATKLSKAAKLKKKKAKASEEKGADGKSPKEFTIAKKSSDSTGSPQVEKIVLAKRQDSSTSVQKESSTNSPTSSLSGAKLAQRSDKSSYKSSEAKTSILESKSALQAGEGSGTSAGSPIEKPSSRRTRKGKTFSTEQAAGLKPAGEASTFPKKGKKSINKSGANLENQQTTEANIASSPRQTNNGQESSKKSDLGTTGLVNNSGSEANSDRPGTETKFKSKAKPKISKPKGPSFGSKFGDAENSTGFKSPTESNESGAVSTKPAFKKLSYKPTDETSGEPRAPKPPRNREANPKFGGKPGQSEEGGDAKSKPKKYRPKPNKPAAGTGPASGTQPNA

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.24
2	0.34
3	0.43
4	0.5
5	0.55
6	0.61
7	0.69
8	0.75
9	0.75
10	0.74
11	0.76
12	0.8
13	0.83
14	0.82
15	0.79
16	0.71
17	0.65
18	0.58
19	0.5
20	0.42
21	0.36
22	0.37
23	0.37
24	0.39
25	0.35
26	0.35
27	0.37
28	0.4
29	0.44
30	0.46
31	0.48
32	0.53
33	0.6
34	0.6
35	0.57
36	0.56
37	0.51
38	0.48
39	0.38
40	0.33
41	0.29
42	0.3
43	0.31
44	0.27
45	0.27
46	0.25
47	0.29
48	0.29
49	0.26
50	0.28
51	0.35
52	0.38
53	0.39
54	0.37
55	0.35
56	0.4
57	0.43
58	0.38
59	0.31
60	0.28
61	0.29
62	0.34
63	0.32
64	0.3
65	0.31
66	0.34
67	0.38
68	0.44
69	0.42
70	0.41
71	0.48
72	0.54
73	0.55
74	0.61
75	0.63
76	0.66
77	0.7
78	0.66
79	0.67
80	0.62
81	0.61
82	0.55
83	0.52
84	0.47
85	0.48
86	0.52
87	0.44
88	0.43
89	0.4
90	0.42
91	0.36
92	0.4
93	0.36
94	0.33
95	0.42
96	0.41
97	0.44
98	0.41
99	0.43
100	0.37
101	0.41
102	0.41
103	0.33
104	0.34
105	0.31
106	0.29
107	0.27
108	0.26
109	0.19
110	0.17
111	0.15
112	0.14
113	0.11
114	0.11
115	0.15
116	0.14
117	0.16
118	0.24
119	0.26
120	0.31
121	0.33
122	0.38
123	0.36
124	0.42
125	0.47
126	0.39
127	0.44
128	0.4
129	0.4
130	0.38
131	0.36
132	0.32
133	0.27
134	0.26
135	0.19
136	0.16
137	0.16
138	0.14
139	0.16
140	0.13
141	0.13
142	0.14
143	0.14
144	0.17
145	0.16
146	0.16
147	0.19
148	0.2
149	0.23
150	0.27
151	0.34
152	0.35
153	0.42
154	0.48
155	0.48
156	0.48
157	0.49
158	0.49
159	0.45
160	0.44
161	0.37
162	0.33
163	0.26
164	0.26
165	0.21
166	0.16
167	0.15
168	0.12
169	0.12
170	0.1
171	0.1
172	0.13
173	0.15
174	0.18
175	0.2
176	0.21
177	0.23
178	0.24
179	0.26
180	0.25
181	0.25
182	0.23
183	0.23
184	0.26
185	0.29
186	0.34
187	0.36
188	0.41
189	0.43
190	0.42
191	0.41
192	0.45
193	0.5
194	0.52
195	0.58
196	0.62
197	0.69
198	0.74
199	0.74
200	0.69
201	0.61
202	0.59
203	0.53
204	0.52
205	0.44
206	0.41
207	0.37
208	0.38
209	0.41
210	0.38
211	0.34
212	0.27
213	0.28
214	0.3
215	0.35
216	0.38
217	0.43
218	0.48
219	0.56
220	0.65
221	0.69
222	0.76
223	0.81
224	0.81
225	0.82
226	0.85
227	0.83
228	0.78
229	0.75
230	0.65
231	0.59
232	0.52
233	0.42
234	0.31
235	0.25
236	0.19
237	0.14
238	0.13
239	0.09
240	0.09
241	0.09
242	0.11
243	0.16
244	0.23
245	0.32
246	0.41
247	0.51
248	0.6
249	0.68
250	0.75
251	0.77
252	0.79
253	0.81
254	0.82
255	0.79
256	0.77
257	0.7
258	0.63
259	0.57
260	0.48
261	0.39
262	0.31
263	0.26
264	0.2
265	0.19
266	0.17
267	0.19
268	0.21
269	0.22
270	0.31
271	0.32
272	0.3
273	0.31
274	0.31
275	0.29
276	0.29
277	0.27
278	0.19
279	0.25
280	0.25
281	0.24
282	0.23
283	0.22
284	0.2
285	0.19
286	0.18
287	0.15
288	0.17
289	0.18
290	0.19
291	0.19
292	0.2
293	0.21
294	0.2
295	0.19
296	0.24
297	0.27
298	0.26
299	0.26
300	0.26
301	0.26
302	0.26
303	0.27
304	0.22
305	0.19
306	0.19
307	0.2
308	0.19
309	0.19
310	0.18
311	0.14
312	0.11
313	0.12
314	0.13
315	0.14
316	0.16
317	0.16
318	0.19
319	0.2
320	0.23
321	0.27
322	0.3
323	0.32
324	0.34
325	0.36
326	0.36
327	0.4
328	0.38
329	0.4
330	0.36
331	0.33
332	0.3
333	0.3
334	0.31
335	0.26
336	0.24
337	0.18
338	0.18
339	0.18
340	0.18
341	0.15
342	0.09
343	0.09
344	0.09
345	0.09
346	0.07
347	0.06
348	0.06
349	0.06
350	0.06
351	0.05
352	0.05
353	0.05
354	0.05
355	0.07
356	0.12
357	0.13
358	0.17
359	0.26
360	0.38
361	0.43
362	0.52
363	0.59
364	0.65
365	0.73
366	0.8
367	0.78
368	0.73
369	0.73
370	0.69
371	0.67
372	0.58
373	0.48
374	0.44
375	0.36
376	0.31
377	0.24
378	0.19
379	0.13
380	0.11
381	0.11
382	0.06
383	0.07
384	0.12
385	0.21
386	0.23
387	0.24
388	0.3
389	0.32
390	0.39
391	0.49
392	0.54
393	0.54
394	0.62
395	0.71
396	0.71
397	0.72
398	0.72
399	0.67
400	0.6
401	0.54
402	0.46
403	0.39
404	0.33
405	0.32
406	0.25
407	0.2
408	0.18
409	0.14
410	0.12
411	0.09
412	0.11
413	0.11
414	0.15
415	0.16
416	0.16
417	0.2
418	0.21
419	0.27
420	0.33
421	0.38
422	0.37
423	0.38
424	0.43
425	0.47
426	0.48
427	0.42
428	0.35
429	0.32
430	0.31
431	0.3
432	0.26
433	0.19
434	0.2
435	0.19
436	0.2
437	0.16
438	0.15
439	0.13
440	0.11
441	0.1
442	0.09
443	0.11
444	0.12
445	0.15
446	0.16
447	0.15
448	0.17
449	0.2
450	0.23
451	0.29
452	0.32
453	0.36
454	0.45
455	0.49
456	0.56
457	0.63
458	0.69
459	0.71
460	0.76
461	0.79
462	0.82
463	0.88
464	0.87
465	0.85
466	0.86
467	0.84
468	0.78
469	0.77
470	0.73
471	0.72
472	0.65
473	0.6
474	0.5
475	0.42
476	0.44
477	0.35
478	0.29
479	0.23
480	0.22
481	0.2
482	0.21
483	0.2
484	0.15
485	0.18
486	0.19
487	0.21
488	0.28
489	0.28
490	0.28
491	0.31
492	0.32
493	0.29
494	0.28
495	0.24
496	0.17
497	0.19
498	0.25
499	0.23
500	0.28
501	0.3
502	0.3
503	0.4
504	0.47
505	0.56
506	0.54
507	0.58
508	0.56
509	0.59
510	0.62
511	0.54
512	0.49
513	0.44
514	0.46
515	0.44
516	0.43
517	0.4
518	0.44
519	0.5
520	0.54
521	0.58
522	0.62
523	0.67
524	0.74
525	0.8
526	0.81
527	0.83
528	0.85
529	0.79
530	0.74
531	0.67
532	0.63
533	0.64
534	0.55
535	0.52
536	0.47
537	0.48
538	0.41
539	0.41
540	0.39
541	0.36
542	0.34
543	0.29
544	0.26
545	0.29
546	0.37
547	0.43
548	0.49
549	0.54
550	0.64
551	0.73
552	0.83
553	0.86
554	0.89
555	0.93
556	0.94
557	0.95
558	0.88
559	0.87
560	0.81
561	0.78
562	0.69
563	0.59
564	0.51
565	0.42
566	0.38

A0A137P3Z8

3D AlphaFold-predicted Structure Viewer