Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NWX1

Protein Details
Accession A0A137NWX1    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MKTGKRSVSIKKKNHIPRPKNSFMIHydrophilic
NLS Segment(s)
PositionSequence
12-13KK
Subcellular Location(s) nucl 19.5, mito_nucl 14.333, cyto_nucl 10.666, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd01389  HMG-box_ROX1-like  
Amino Acid Sequences MKTGKRSVSIKKKNHIPRPKNSFMIYRQEKQYEAAKHIEGSNNKDISKLVGKWWNNETEEVKAYYRKKAEEAKKVHSKLYPNYRYCPKKSVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.87
3 0.84
4 0.85
5 0.86
6 0.83
7 0.78
8 0.71
9 0.66
10 0.6
11 0.62
12 0.58
13 0.53
14 0.51
15 0.48
16 0.45
17 0.42
18 0.44
19 0.36
20 0.33
21 0.31
22 0.26
23 0.26
24 0.26
25 0.29
26 0.24
27 0.26
28 0.29
29 0.28
30 0.27
31 0.27
32 0.25
33 0.23
34 0.24
35 0.19
36 0.17
37 0.23
38 0.24
39 0.27
40 0.29
41 0.31
42 0.28
43 0.3
44 0.28
45 0.23
46 0.24
47 0.23
48 0.22
49 0.24
50 0.25
51 0.29
52 0.3
53 0.29
54 0.33
55 0.41
56 0.48
57 0.52
58 0.56
59 0.59
60 0.66
61 0.66
62 0.65
63 0.6
64 0.58
65 0.57
66 0.62
67 0.63
68 0.57
69 0.63
70 0.69
71 0.73
72 0.71