Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P8F8

Protein Details
Accession A0A137P8F8   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
114-137HCCEEIKPKDPKKKNMSNKSNFDEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto 6, mito 3, vacu 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008585  Gamma_PGA_hydro  
IPR038128  Gamma_PGA_hydro_sf  
Pfam View protein in Pfam  
PF05908  Gamma_PGA_hydro  
Amino Acid Sequences MLLINYIFSISATFAFTDYFANVTELYKNLKDPKEVSEVSNSTGAKQIFNSDGVQVVSLAVHGNKIEPQTEEFSKMLYERVIGTRGKSALYSFLSNIDSTESMKYNNDRCTPTHCCEEIKPKDPKKKNMSNKSNFDEKNCQKYGLKTIKVCNYEKVCYKNAAHVTSENFNTTKINELIDCRYPVSFHGYQDRKYKNGALTSHIVLGGLSNQKYKLAETFHKMSGGAFKVAVCKTAGNCRVYDENNEFDKRTKIDGSGLTGTSKDNFVNKGKGGCGLQIELATTFRNLKGEDRKHWNSLVESIFCTLPNNESEICDPERPIGNTQEDAEEDESEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.11
4 0.11
5 0.11
6 0.11
7 0.1
8 0.11
9 0.11
10 0.12
11 0.14
12 0.14
13 0.19
14 0.19
15 0.24
16 0.31
17 0.34
18 0.37
19 0.37
20 0.41
21 0.45
22 0.45
23 0.42
24 0.42
25 0.4
26 0.37
27 0.41
28 0.35
29 0.28
30 0.32
31 0.3
32 0.22
33 0.22
34 0.23
35 0.19
36 0.21
37 0.21
38 0.16
39 0.17
40 0.16
41 0.16
42 0.12
43 0.1
44 0.08
45 0.08
46 0.08
47 0.06
48 0.07
49 0.07
50 0.08
51 0.1
52 0.12
53 0.13
54 0.14
55 0.17
56 0.21
57 0.23
58 0.26
59 0.23
60 0.22
61 0.21
62 0.2
63 0.19
64 0.14
65 0.13
66 0.11
67 0.13
68 0.17
69 0.16
70 0.17
71 0.2
72 0.21
73 0.2
74 0.18
75 0.17
76 0.18
77 0.2
78 0.2
79 0.16
80 0.18
81 0.18
82 0.18
83 0.17
84 0.14
85 0.12
86 0.12
87 0.14
88 0.12
89 0.12
90 0.15
91 0.2
92 0.23
93 0.29
94 0.32
95 0.32
96 0.33
97 0.4
98 0.44
99 0.43
100 0.44
101 0.39
102 0.37
103 0.38
104 0.47
105 0.46
106 0.48
107 0.54
108 0.56
109 0.65
110 0.7
111 0.76
112 0.75
113 0.79
114 0.82
115 0.83
116 0.86
117 0.84
118 0.83
119 0.78
120 0.77
121 0.68
122 0.62
123 0.61
124 0.55
125 0.55
126 0.49
127 0.47
128 0.39
129 0.41
130 0.45
131 0.43
132 0.43
133 0.38
134 0.42
135 0.46
136 0.5
137 0.48
138 0.45
139 0.4
140 0.39
141 0.4
142 0.39
143 0.34
144 0.33
145 0.32
146 0.32
147 0.33
148 0.31
149 0.28
150 0.25
151 0.26
152 0.24
153 0.24
154 0.19
155 0.15
156 0.14
157 0.13
158 0.12
159 0.13
160 0.11
161 0.11
162 0.11
163 0.12
164 0.15
165 0.16
166 0.17
167 0.14
168 0.13
169 0.13
170 0.13
171 0.19
172 0.18
173 0.17
174 0.26
175 0.28
176 0.32
177 0.4
178 0.42
179 0.36
180 0.36
181 0.39
182 0.33
183 0.36
184 0.33
185 0.28
186 0.29
187 0.28
188 0.27
189 0.23
190 0.19
191 0.13
192 0.12
193 0.12
194 0.12
195 0.12
196 0.12
197 0.12
198 0.14
199 0.14
200 0.15
201 0.15
202 0.17
203 0.2
204 0.25
205 0.29
206 0.28
207 0.29
208 0.28
209 0.25
210 0.26
211 0.23
212 0.18
213 0.15
214 0.14
215 0.18
216 0.19
217 0.19
218 0.14
219 0.14
220 0.15
221 0.24
222 0.29
223 0.26
224 0.26
225 0.28
226 0.32
227 0.32
228 0.36
229 0.3
230 0.3
231 0.34
232 0.35
233 0.33
234 0.31
235 0.33
236 0.29
237 0.29
238 0.25
239 0.22
240 0.25
241 0.26
242 0.29
243 0.28
244 0.27
245 0.24
246 0.23
247 0.22
248 0.19
249 0.18
250 0.15
251 0.14
252 0.18
253 0.22
254 0.26
255 0.27
256 0.29
257 0.28
258 0.3
259 0.28
260 0.26
261 0.23
262 0.19
263 0.18
264 0.16
265 0.16
266 0.13
267 0.14
268 0.12
269 0.11
270 0.13
271 0.13
272 0.15
273 0.16
274 0.23
275 0.32
276 0.39
277 0.46
278 0.54
279 0.58
280 0.6
281 0.62
282 0.58
283 0.5
284 0.49
285 0.45
286 0.37
287 0.33
288 0.31
289 0.28
290 0.25
291 0.24
292 0.19
293 0.17
294 0.16
295 0.19
296 0.17
297 0.19
298 0.21
299 0.24
300 0.27
301 0.26
302 0.26
303 0.27
304 0.33
305 0.33
306 0.35
307 0.37
308 0.36
309 0.37
310 0.37
311 0.35
312 0.3
313 0.31
314 0.29