Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P899

Protein Details
Accession A0A137P899    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
41-63ENLPRLKTIKKKYDPENRFRFKQHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012951  BBE  
IPR016169  FAD-bd_PCMH_sub2  
Gene Ontology GO:0050660  F:flavin adenine dinucleotide binding  
GO:0016491  F:oxidoreductase activity  
Pfam View protein in Pfam  
PF08031  BBE  
Amino Acid Sequences QVSEDWGETYFERLEGMLSNESFQNYIDAKAGNSYQKYYAENLPRLKTIKKKYDPENRFRFKQSIPLA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.13
4 0.13
5 0.12
6 0.13
7 0.14
8 0.14
9 0.13
10 0.12
11 0.12
12 0.1
13 0.11
14 0.11
15 0.1
16 0.1
17 0.11
18 0.13
19 0.12
20 0.12
21 0.13
22 0.14
23 0.15
24 0.16
25 0.17
26 0.22
27 0.26
28 0.31
29 0.34
30 0.34
31 0.36
32 0.37
33 0.4
34 0.43
35 0.46
36 0.51
37 0.56
38 0.62
39 0.69
40 0.77
41 0.81
42 0.82
43 0.83
44 0.8
45 0.77
46 0.74
47 0.7
48 0.6