Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PCL4

Protein Details
Accession A0A137PCL4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
3-31SSEIVFKARKGKNNLRKRKQQIDEDKASDHydrophilic
NLS Segment(s)
PositionSequence
10-21ARKGKNNLRKRK
110-112KKK
Subcellular Location(s) nucl 24, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR010756  Tls1-like  
Gene Ontology GO:0005634  C:nucleus  
Pfam View protein in Pfam  
PF07052  Hep_59  
Amino Acid Sequences MESSEIVFKARKGKNNLRKRKQQIDEDKASDNEPEIAENISNILELRKLKQRANGAKIGTLPDIEDNSKENDREREELNPVTKLSLQNFIQESSLEQAEKTKASEEEKLKKKRLKINFDQNYNLLEEEEEGEKEKIKSRNVSKEAPTSSSMVAGIEEVDLGIESRLKNIEETEKAKRDLLLQKDKQDNTELRGIKTYHSKGNMNQPKVDYSTGATDLQVMDQFKKRTSRH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.76
3 0.84
4 0.84
5 0.89
6 0.9
7 0.91
8 0.89
9 0.89
10 0.89
11 0.87
12 0.85
13 0.77
14 0.72
15 0.62
16 0.54
17 0.44
18 0.34
19 0.27
20 0.19
21 0.16
22 0.13
23 0.13
24 0.12
25 0.11
26 0.11
27 0.08
28 0.08
29 0.07
30 0.07
31 0.09
32 0.11
33 0.15
34 0.23
35 0.28
36 0.3
37 0.37
38 0.46
39 0.52
40 0.56
41 0.58
42 0.51
43 0.49
44 0.47
45 0.43
46 0.33
47 0.24
48 0.19
49 0.15
50 0.16
51 0.14
52 0.14
53 0.13
54 0.16
55 0.18
56 0.19
57 0.2
58 0.23
59 0.26
60 0.27
61 0.27
62 0.27
63 0.28
64 0.31
65 0.3
66 0.27
67 0.23
68 0.22
69 0.23
70 0.22
71 0.19
72 0.22
73 0.2
74 0.23
75 0.23
76 0.23
77 0.21
78 0.18
79 0.17
80 0.13
81 0.14
82 0.09
83 0.08
84 0.1
85 0.11
86 0.11
87 0.11
88 0.1
89 0.12
90 0.14
91 0.21
92 0.25
93 0.33
94 0.42
95 0.49
96 0.54
97 0.56
98 0.61
99 0.62
100 0.66
101 0.65
102 0.65
103 0.69
104 0.69
105 0.68
106 0.63
107 0.56
108 0.47
109 0.39
110 0.3
111 0.18
112 0.12
113 0.09
114 0.08
115 0.08
116 0.07
117 0.08
118 0.08
119 0.1
120 0.11
121 0.17
122 0.2
123 0.23
124 0.3
125 0.35
126 0.45
127 0.48
128 0.52
129 0.5
130 0.52
131 0.5
132 0.46
133 0.4
134 0.32
135 0.27
136 0.23
137 0.2
138 0.13
139 0.11
140 0.08
141 0.07
142 0.05
143 0.04
144 0.03
145 0.03
146 0.03
147 0.03
148 0.03
149 0.05
150 0.05
151 0.07
152 0.09
153 0.09
154 0.1
155 0.12
156 0.17
157 0.21
158 0.26
159 0.33
160 0.36
161 0.37
162 0.38
163 0.36
164 0.38
165 0.4
166 0.45
167 0.47
168 0.48
169 0.54
170 0.61
171 0.61
172 0.56
173 0.56
174 0.49
175 0.42
176 0.46
177 0.41
178 0.34
179 0.38
180 0.37
181 0.33
182 0.4
183 0.4
184 0.38
185 0.41
186 0.43
187 0.43
188 0.53
189 0.59
190 0.54
191 0.54
192 0.5
193 0.49
194 0.48
195 0.45
196 0.35
197 0.28
198 0.29
199 0.27
200 0.25
201 0.21
202 0.19
203 0.18
204 0.18
205 0.19
206 0.17
207 0.19
208 0.25
209 0.28
210 0.32