Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P6D8

Protein Details
Accession A0A137P6D8   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
77-104RLNIEKPKKKEYKKPFDREKRENYKKLYBasic
NLS Segment(s)
PositionSequence
81-114EKPKKKEYKKPFDREKRENYKKLYPKSDTKGNKP
Subcellular Location(s) nucl 13.5, mito 12, cyto_nucl 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR010487  NGRN/Rrg9  
Gene Ontology GO:0005739  C:mitochondrion  
Pfam View protein in Pfam  
PF06413  Neugrin  
Amino Acid Sequences MSNQFRNLIININKRVTINNTFNIGQLPKFYSQKPTNTAFESLQSDNTSNNSKKEENVEALITSNKLKIKNLNWGERLNIEKPKKKEYKKPFDREKRENYKKLYPKSDTKGNKPAWLIHKEALKTKLAGDKWEPEKRLSRMAMDKIRFLHKELGDEFNVPKLSAEFKVSPESIRRILKSNYKPTQEVIERQESNRKSKRIEFVKQFQPVKEKKEEVESESVIPRQFGTYEEYKIYLNEMKKKNKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.44
2 0.46
3 0.44
4 0.44
5 0.42
6 0.39
7 0.41
8 0.39
9 0.39
10 0.4
11 0.35
12 0.27
13 0.24
14 0.24
15 0.25
16 0.28
17 0.29
18 0.35
19 0.39
20 0.45
21 0.48
22 0.49
23 0.48
24 0.48
25 0.5
26 0.41
27 0.38
28 0.36
29 0.32
30 0.29
31 0.26
32 0.24
33 0.21
34 0.23
35 0.27
36 0.25
37 0.27
38 0.29
39 0.28
40 0.3
41 0.35
42 0.36
43 0.31
44 0.31
45 0.29
46 0.24
47 0.24
48 0.23
49 0.18
50 0.15
51 0.15
52 0.16
53 0.17
54 0.19
55 0.25
56 0.27
57 0.36
58 0.42
59 0.46
60 0.46
61 0.46
62 0.45
63 0.42
64 0.43
65 0.36
66 0.38
67 0.38
68 0.42
69 0.44
70 0.53
71 0.59
72 0.62
73 0.68
74 0.7
75 0.75
76 0.78
77 0.85
78 0.86
79 0.87
80 0.9
81 0.88
82 0.88
83 0.87
84 0.86
85 0.83
86 0.78
87 0.76
88 0.75
89 0.73
90 0.7
91 0.64
92 0.62
93 0.6
94 0.64
95 0.59
96 0.57
97 0.6
98 0.54
99 0.52
100 0.46
101 0.46
102 0.43
103 0.41
104 0.37
105 0.31
106 0.33
107 0.3
108 0.32
109 0.3
110 0.24
111 0.21
112 0.21
113 0.23
114 0.2
115 0.21
116 0.2
117 0.24
118 0.3
119 0.35
120 0.34
121 0.32
122 0.38
123 0.38
124 0.41
125 0.35
126 0.32
127 0.33
128 0.38
129 0.42
130 0.37
131 0.38
132 0.34
133 0.38
134 0.35
135 0.32
136 0.33
137 0.27
138 0.29
139 0.29
140 0.3
141 0.26
142 0.27
143 0.24
144 0.21
145 0.2
146 0.16
147 0.14
148 0.12
149 0.13
150 0.13
151 0.17
152 0.15
153 0.16
154 0.2
155 0.21
156 0.22
157 0.23
158 0.26
159 0.28
160 0.3
161 0.3
162 0.31
163 0.36
164 0.44
165 0.49
166 0.55
167 0.57
168 0.57
169 0.57
170 0.53
171 0.57
172 0.51
173 0.48
174 0.44
175 0.45
176 0.42
177 0.43
178 0.51
179 0.46
180 0.51
181 0.54
182 0.52
183 0.49
184 0.54
185 0.62
186 0.62
187 0.68
188 0.67
189 0.68
190 0.73
191 0.76
192 0.72
193 0.66
194 0.67
195 0.63
196 0.6
197 0.6
198 0.54
199 0.48
200 0.54
201 0.53
202 0.48
203 0.49
204 0.44
205 0.39
206 0.39
207 0.39
208 0.31
209 0.28
210 0.23
211 0.19
212 0.17
213 0.15
214 0.19
215 0.2
216 0.23
217 0.24
218 0.25
219 0.24
220 0.24
221 0.27
222 0.27
223 0.3
224 0.36
225 0.44