Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NVH3

Protein Details
Accession A0A137NVH3    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
42-82YELLESPKKRKKTNKKLGRPKKVEKKEVAKKPSKKEKKITDBasic
NLS Segment(s)
PositionSequence
48-80PKKRKKTNKKLGRPKKVEKKEVAKKPSKKEKKI
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
Amino Acid Sequences MDDFDSMDDFVEVNDVPEPMFTKSGRPLRQATLKKAPSSLYYELLESPKKRKKTNKKLGRPKKVEKKEVAKKPSKKEKKITD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.07
3 0.07
4 0.08
5 0.1
6 0.1
7 0.13
8 0.12
9 0.15
10 0.23
11 0.31
12 0.34
13 0.37
14 0.38
15 0.41
16 0.5
17 0.52
18 0.51
19 0.53
20 0.52
21 0.49
22 0.47
23 0.43
24 0.36
25 0.36
26 0.31
27 0.23
28 0.21
29 0.2
30 0.2
31 0.21
32 0.22
33 0.19
34 0.25
35 0.3
36 0.35
37 0.42
38 0.52
39 0.61
40 0.69
41 0.78
42 0.81
43 0.85
44 0.91
45 0.95
46 0.95
47 0.93
48 0.92
49 0.92
50 0.91
51 0.89
52 0.87
53 0.87
54 0.86
55 0.86
56 0.86
57 0.85
58 0.84
59 0.85
60 0.88
61 0.88
62 0.87