Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PBQ8

Protein Details
Accession A0A137PBQ8   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
2-30VVSIVKTKIVKKRTKPFRRHQADRFARMNHydrophilic
NLS Segment(s)
PositionSequence
9-37KIVKKRTKPFRRHQADRFARMNPAWRKPK
Subcellular Location(s) mito 19, cyto 4.5, cyto_nucl 4.5, nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MVVSIVKTKIVKKRTKPFRRHQADRFARMNPAWRKPKGIDNCVRRRFKGTLPMPSIGYGSNKKTRHLTPDGFKRVVVSNTKDLEPLVMNNRSFAAEIAHNVSSKKRLLIVARAKQLNIKVTNAGARIRTEEH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.83
3 0.87
4 0.89
5 0.91
6 0.91
7 0.91
8 0.88
9 0.88
10 0.86
11 0.83
12 0.76
13 0.66
14 0.61
15 0.53
16 0.54
17 0.5
18 0.51
19 0.51
20 0.49
21 0.53
22 0.51
23 0.59
24 0.58
25 0.6
26 0.59
27 0.61
28 0.7
29 0.74
30 0.75
31 0.67
32 0.64
33 0.58
34 0.53
35 0.53
36 0.48
37 0.47
38 0.47
39 0.47
40 0.42
41 0.39
42 0.36
43 0.26
44 0.24
45 0.18
46 0.19
47 0.25
48 0.25
49 0.26
50 0.3
51 0.31
52 0.34
53 0.38
54 0.38
55 0.37
56 0.46
57 0.51
58 0.47
59 0.45
60 0.39
61 0.36
62 0.35
63 0.32
64 0.26
65 0.26
66 0.27
67 0.27
68 0.26
69 0.23
70 0.21
71 0.18
72 0.16
73 0.16
74 0.19
75 0.19
76 0.19
77 0.2
78 0.19
79 0.18
80 0.16
81 0.13
82 0.09
83 0.11
84 0.14
85 0.15
86 0.15
87 0.15
88 0.17
89 0.19
90 0.19
91 0.19
92 0.18
93 0.21
94 0.25
95 0.34
96 0.42
97 0.46
98 0.53
99 0.53
100 0.51
101 0.51
102 0.52
103 0.5
104 0.42
105 0.37
106 0.31
107 0.32
108 0.36
109 0.34
110 0.32
111 0.27
112 0.26