Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PGX4

Protein Details
Accession A0A137PGX4    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
30-55PLSTTPTKKCKKSCRRFKRVFRFLIGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 15, pero 3, E.R. 3, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MAKKTDYYPVEDHENDGLLKLDGNVTQDLPLSTTPTKKCKKSCRRFKRVFRFLIGFLAIPLIVYVYFYGFNSPFHFNEFNA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.23
3 0.21
4 0.18
5 0.11
6 0.11
7 0.09
8 0.09
9 0.08
10 0.1
11 0.1
12 0.1
13 0.1
14 0.1
15 0.1
16 0.1
17 0.1
18 0.11
19 0.12
20 0.17
21 0.2
22 0.29
23 0.35
24 0.4
25 0.48
26 0.56
27 0.66
28 0.71
29 0.79
30 0.82
31 0.86
32 0.9
33 0.93
34 0.93
35 0.91
36 0.84
37 0.77
38 0.69
39 0.59
40 0.52
41 0.41
42 0.3
43 0.21
44 0.17
45 0.12
46 0.08
47 0.07
48 0.05
49 0.04
50 0.04
51 0.05
52 0.05
53 0.06
54 0.06
55 0.1
56 0.11
57 0.13
58 0.16
59 0.2
60 0.2
61 0.25