Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P806

Protein Details
Accession A0A137P806    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-20KKKKWSKGKVKDKANNSVTFHydrophilic
NLS Segment(s)
PositionSequence
2-10KKKWSKGKV
Subcellular Location(s) mito 15, mito_nucl 12.666, cyto_mito 9.166, nucl 9, cyto_nucl 6.166
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences KKKKWSKGKVKDKANNSVTFDQATLDKLLKEVPTYKLVTPSVLVDRLRISGSLARQAIKDLETQGLIKLVSAHSSQLIYTRATAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.71
4 0.63
5 0.54
6 0.46
7 0.39
8 0.29
9 0.23
10 0.19
11 0.14
12 0.12
13 0.11
14 0.1
15 0.12
16 0.11
17 0.12
18 0.14
19 0.15
20 0.18
21 0.21
22 0.21
23 0.23
24 0.23
25 0.22
26 0.19
27 0.18
28 0.15
29 0.16
30 0.16
31 0.12
32 0.12
33 0.13
34 0.13
35 0.11
36 0.11
37 0.11
38 0.12
39 0.17
40 0.17
41 0.17
42 0.17
43 0.18
44 0.18
45 0.16
46 0.16
47 0.12
48 0.13
49 0.13
50 0.13
51 0.12
52 0.13
53 0.11
54 0.1
55 0.1
56 0.09
57 0.11
58 0.11
59 0.12
60 0.12
61 0.12
62 0.12
63 0.15
64 0.16
65 0.15