Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JSQ7

Protein Details
Accession G3JSQ7    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
12-36SLSHPVSRQDPKRRQNMKKSKVLRNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, mito 10, cyto 3
Family & Domain DBs
KEGG cmt:CCM_08950  -  
Amino Acid Sequences MYPIPHTKGLFSLSHPVSRQDPKRRQNMKKSKVLRNLAANVVPMHASQQADYLLLAFYMLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.31
4 0.33
5 0.4
6 0.47
7 0.49
8 0.57
9 0.6
10 0.7
11 0.77
12 0.8
13 0.83
14 0.85
15 0.82
16 0.82
17 0.82
18 0.8
19 0.79
20 0.75
21 0.68
22 0.62
23 0.57
24 0.5
25 0.43
26 0.35
27 0.26
28 0.22
29 0.18
30 0.12
31 0.12
32 0.12
33 0.12
34 0.1
35 0.12
36 0.12
37 0.12
38 0.12
39 0.11
40 0.08
41 0.07