Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P804

Protein Details
Accession A0A137P804    Localization Confidence High Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
2-28FISHQDPSLKKRPRRRHHEVERLYQCNHydrophilic
NLS Segment(s)
PositionSequence
11-17KKRPRRR
55-73RLPAEFKEIRKLWKAKKEK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR039327  CON7-like  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0006355  P:regulation of DNA-templated transcription  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
PS50157  ZINC_FINGER_C2H2_2  
Amino Acid Sequences SFISHQDPSLKKRPRRRHHEVERLYQCNFPRCPKAYGTLNHLNAHVLSQNHGPKRLPAEFKEIRKLWKAKKEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.84
3 0.86
4 0.87
5 0.89
6 0.91
7 0.87
8 0.86
9 0.84
10 0.77
11 0.68
12 0.61
13 0.53
14 0.49
15 0.45
16 0.38
17 0.37
18 0.37
19 0.38
20 0.35
21 0.38
22 0.37
23 0.36
24 0.39
25 0.4
26 0.39
27 0.37
28 0.36
29 0.31
30 0.25
31 0.24
32 0.19
33 0.12
34 0.11
35 0.16
36 0.22
37 0.24
38 0.27
39 0.27
40 0.27
41 0.34
42 0.39
43 0.39
44 0.36
45 0.43
46 0.48
47 0.52
48 0.59
49 0.54
50 0.53
51 0.57
52 0.63
53 0.63