Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NWU8

Protein Details
Accession A0A137NWU8    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MGKSSKNFKRPTKKEKDQIKLKKSFAHydrophilic
NLS Segment(s)
PositionSequence
8-18FKRPTKKEKDQ
Subcellular Location(s) nucl 20.5, cyto_nucl 12, mito 4
Family & Domain DBs
Amino Acid Sequences MGKSSKNFKRPTKKEKDQIKLKKSFAPSTTNEPADEPSLNTKTKSTIAKKGQDQDIKKNLEKFAKELNKEEVKVVSKHEEHQEKKEEEVVKKDYVDLMFGKKTYKPLFAKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.91
3 0.9
4 0.9
5 0.9
6 0.89
7 0.86
8 0.79
9 0.76
10 0.71
11 0.67
12 0.59
13 0.55
14 0.48
15 0.48
16 0.51
17 0.45
18 0.4
19 0.34
20 0.32
21 0.28
22 0.26
23 0.18
24 0.18
25 0.2
26 0.21
27 0.2
28 0.19
29 0.19
30 0.23
31 0.3
32 0.29
33 0.35
34 0.41
35 0.46
36 0.5
37 0.53
38 0.56
39 0.55
40 0.53
41 0.52
42 0.52
43 0.5
44 0.48
45 0.46
46 0.42
47 0.4
48 0.38
49 0.33
50 0.35
51 0.38
52 0.37
53 0.37
54 0.41
55 0.39
56 0.39
57 0.38
58 0.32
59 0.29
60 0.28
61 0.28
62 0.27
63 0.25
64 0.28
65 0.35
66 0.4
67 0.41
68 0.46
69 0.52
70 0.47
71 0.47
72 0.5
73 0.48
74 0.42
75 0.45
76 0.43
77 0.37
78 0.36
79 0.35
80 0.32
81 0.26
82 0.26
83 0.21
84 0.22
85 0.22
86 0.22
87 0.24
88 0.23
89 0.31
90 0.33
91 0.4