Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NRK3

Protein Details
Accession A0A137NRK3    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MPTIIKSPNNKPKPSKKKLQIFLSVAHydrophilic
NLS Segment(s)
PositionSequence
13-14KP
16-16K
Subcellular Location(s) E.R. 7, pero 4, nucl 3.5, cyto_nucl 3.5, mito 3, golg 3, cyto 2.5, extr 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPTIIKSPNNKPKPSKKKLQIFLSVAIILAAAVIAGVVYGYVQPRNRRIKECQNSLTITRLTCTHICTQEQEICNKNCDEDDYICILACYESNDKCTKECSNVVLKEGEKCKNM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.84
4 0.86
5 0.88
6 0.86
7 0.83
8 0.75
9 0.69
10 0.61
11 0.5
12 0.4
13 0.3
14 0.22
15 0.12
16 0.08
17 0.05
18 0.02
19 0.02
20 0.02
21 0.01
22 0.01
23 0.01
24 0.01
25 0.02
26 0.03
27 0.04
28 0.07
29 0.11
30 0.15
31 0.24
32 0.33
33 0.37
34 0.41
35 0.48
36 0.56
37 0.61
38 0.65
39 0.6
40 0.53
41 0.52
42 0.48
43 0.43
44 0.33
45 0.25
46 0.18
47 0.16
48 0.16
49 0.15
50 0.17
51 0.18
52 0.19
53 0.2
54 0.22
55 0.25
56 0.27
57 0.28
58 0.29
59 0.31
60 0.29
61 0.31
62 0.29
63 0.26
64 0.21
65 0.22
66 0.21
67 0.17
68 0.19
69 0.19
70 0.19
71 0.18
72 0.17
73 0.15
74 0.11
75 0.1
76 0.11
77 0.13
78 0.14
79 0.19
80 0.23
81 0.24
82 0.25
83 0.3
84 0.29
85 0.3
86 0.33
87 0.34
88 0.39
89 0.4
90 0.42
91 0.42
92 0.39
93 0.41
94 0.45