Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137P8N8

Protein Details
Accession A0A137P8N8    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
15-35GFSPRKRTRHHRGSVKSFPKDBasic
NLS Segment(s)
PositionSequence
18-26PRKRTRHHR
Subcellular Location(s) nucl 19, cyto_nucl 12.833, mito_nucl 11.333, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045077  L3_arc_euk  
IPR000597  Ribosomal_L3  
IPR044892  Ribosomal_L3_dom_3_arc_sf  
IPR009000  Transl_B-barrel_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00297  Ribosomal_L3  
Amino Acid Sequences MSHRKFEAPRHGHLGFSPRKRTRHHRGSVKSFPKDDASKPVHLTAFMGYKAGMTHVVRDLDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.43
3 0.46
4 0.51
5 0.5
6 0.55
7 0.61
8 0.69
9 0.7
10 0.72
11 0.74
12 0.74
13 0.76
14 0.79
15 0.83
16 0.81
17 0.74
18 0.64
19 0.57
20 0.51
21 0.46
22 0.38
23 0.37
24 0.33
25 0.32
26 0.33
27 0.34
28 0.3
29 0.27
30 0.26
31 0.2
32 0.19
33 0.16
34 0.14
35 0.11
36 0.11
37 0.11
38 0.12
39 0.14
40 0.12
41 0.15
42 0.19