Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NRT4

Protein Details
Accession A0A137NRT4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
100-125PTHGHPLKKAESRRHKYRFRGNRNNYBasic
NLS Segment(s)
PositionSequence
111-115SRRHK
Subcellular Location(s) extr 14, golg 4, pero 3, E.R. 3, mito 1, cyto 1, vacu 1, cyto_mito 1
Family & Domain DBs
Amino Acid Sequences MKPYTLFLFAQALIADQLVTIVDEFDNIHDGASPNVCFQLPSDKIIKIDIKGDYKMHVFKEKNCGGSSAEIELSGNVRVNGNSKGWLTAVVPKQVIDEQPTHGHPLKKAESRRHKYRFRGNRNNY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.09
3 0.06
4 0.06
5 0.05
6 0.05
7 0.04
8 0.05
9 0.04
10 0.05
11 0.06
12 0.06
13 0.08
14 0.08
15 0.08
16 0.08
17 0.09
18 0.1
19 0.12
20 0.12
21 0.1
22 0.11
23 0.11
24 0.1
25 0.1
26 0.18
27 0.17
28 0.2
29 0.22
30 0.21
31 0.22
32 0.25
33 0.26
34 0.18
35 0.2
36 0.21
37 0.21
38 0.22
39 0.22
40 0.2
41 0.21
42 0.23
43 0.21
44 0.25
45 0.24
46 0.25
47 0.33
48 0.34
49 0.34
50 0.32
51 0.31
52 0.24
53 0.25
54 0.23
55 0.15
56 0.12
57 0.1
58 0.1
59 0.09
60 0.08
61 0.07
62 0.07
63 0.06
64 0.07
65 0.07
66 0.1
67 0.12
68 0.11
69 0.13
70 0.13
71 0.13
72 0.13
73 0.14
74 0.13
75 0.18
76 0.2
77 0.21
78 0.21
79 0.21
80 0.22
81 0.23
82 0.24
83 0.2
84 0.18
85 0.19
86 0.22
87 0.24
88 0.28
89 0.3
90 0.32
91 0.31
92 0.37
93 0.42
94 0.46
95 0.53
96 0.58
97 0.65
98 0.71
99 0.8
100 0.81
101 0.83
102 0.84
103 0.87
104 0.88
105 0.88