Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PIL2

Protein Details
Accession A0A137PIL2    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33AAAAKPTKIVNKKDKKDPNKPKRGRSAYMFHydrophilic
NLS Segment(s)
PositionSequence
7-28AKPTKIVNKKDKKDPNKPKRGR
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF00505  HMG_box  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
Amino Acid Sequences MPKAAAAKPTKIVNKKDKKDPNKPKRGRSAYMFFAQENRERIQKENPKATFGQIGKLMGEEWQKLSDKDKKPYNDKAAADKERYEKEKADYESK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.72
3 0.78
4 0.82
5 0.82
6 0.86
7 0.88
8 0.88
9 0.89
10 0.9
11 0.88
12 0.89
13 0.86
14 0.8
15 0.76
16 0.7
17 0.63
18 0.6
19 0.52
20 0.41
21 0.37
22 0.34
23 0.31
24 0.28
25 0.25
26 0.24
27 0.24
28 0.26
29 0.33
30 0.39
31 0.41
32 0.46
33 0.45
34 0.44
35 0.44
36 0.42
37 0.39
38 0.31
39 0.28
40 0.2
41 0.2
42 0.17
43 0.17
44 0.15
45 0.12
46 0.13
47 0.11
48 0.11
49 0.14
50 0.15
51 0.15
52 0.21
53 0.28
54 0.33
55 0.4
56 0.47
57 0.52
58 0.58
59 0.67
60 0.7
61 0.68
62 0.64
63 0.65
64 0.67
65 0.65
66 0.61
67 0.56
68 0.54
69 0.54
70 0.55
71 0.5
72 0.45
73 0.44
74 0.49