Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P7X9

Protein Details
Accession A0A137P7X9   
Localization Confidence Medium
Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
174-199EEDRQNKQIKKKIDKLQPSKKSKLEDHydrophilic
NLS Segment(s)
PositionSequence
184-184K
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000789  Cyclin-dep_kinase_reg-sub  
IPR036858  Cyclin-dep_kinase_reg-sub_sf  
Gene Ontology GO:0016538  F:cyclin-dependent protein serine/threonine kinase regulator activity  
GO:0007049  P:cell cycle  
GO:0051301  P:cell division  
Pfam View protein in Pfam  
PF01111  CKS  
Amino Acid Sequences MKDEEYEVLINEYKAKRLIKNEIPTELILDINYSPYYTHGDWNYRIVSVPKKLLKYIPRNTLLTNRQWQSVGIIMSDSWEHYQLFEPEPQSMMFRKYVGSQKSSGKAPIPDPQVRKPVVPVPSDELDLDELADEEQSSKSNTKKATKSQSELEESKTNKRKAEKSHNSSEEEAEEDRQNKQIKKKIDKLQPSKKSKLEDNNSQDDDAPKPRRSARISK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.31
3 0.33
4 0.39
5 0.48
6 0.5
7 0.58
8 0.6
9 0.57
10 0.56
11 0.5
12 0.45
13 0.37
14 0.27
15 0.18
16 0.15
17 0.12
18 0.11
19 0.11
20 0.09
21 0.09
22 0.1
23 0.16
24 0.15
25 0.2
26 0.22
27 0.27
28 0.29
29 0.33
30 0.32
31 0.27
32 0.27
33 0.26
34 0.28
35 0.27
36 0.34
37 0.35
38 0.36
39 0.38
40 0.43
41 0.49
42 0.53
43 0.56
44 0.57
45 0.57
46 0.56
47 0.56
48 0.58
49 0.54
50 0.5
51 0.5
52 0.43
53 0.4
54 0.38
55 0.36
56 0.29
57 0.28
58 0.21
59 0.13
60 0.12
61 0.1
62 0.1
63 0.1
64 0.09
65 0.07
66 0.08
67 0.07
68 0.08
69 0.11
70 0.12
71 0.13
72 0.15
73 0.15
74 0.14
75 0.15
76 0.14
77 0.14
78 0.14
79 0.14
80 0.12
81 0.12
82 0.12
83 0.15
84 0.21
85 0.22
86 0.23
87 0.24
88 0.28
89 0.3
90 0.31
91 0.28
92 0.24
93 0.24
94 0.23
95 0.26
96 0.28
97 0.3
98 0.33
99 0.35
100 0.39
101 0.38
102 0.36
103 0.32
104 0.32
105 0.31
106 0.28
107 0.25
108 0.24
109 0.24
110 0.24
111 0.22
112 0.17
113 0.14
114 0.13
115 0.11
116 0.06
117 0.05
118 0.05
119 0.05
120 0.04
121 0.04
122 0.05
123 0.05
124 0.07
125 0.1
126 0.12
127 0.17
128 0.23
129 0.29
130 0.35
131 0.43
132 0.52
133 0.55
134 0.57
135 0.59
136 0.58
137 0.57
138 0.52
139 0.49
140 0.45
141 0.41
142 0.47
143 0.5
144 0.48
145 0.47
146 0.52
147 0.55
148 0.58
149 0.67
150 0.69
151 0.68
152 0.75
153 0.75
154 0.72
155 0.66
156 0.58
157 0.47
158 0.39
159 0.32
160 0.25
161 0.24
162 0.21
163 0.21
164 0.26
165 0.31
166 0.34
167 0.41
168 0.46
169 0.52
170 0.61
171 0.69
172 0.73
173 0.76
174 0.82
175 0.84
176 0.88
177 0.88
178 0.87
179 0.85
180 0.81
181 0.77
182 0.75
183 0.75
184 0.72
185 0.72
186 0.71
187 0.72
188 0.69
189 0.64
190 0.57
191 0.49
192 0.45
193 0.44
194 0.44
195 0.38
196 0.42
197 0.47
198 0.54