Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PGV4

Protein Details
Accession A0A137PGV4    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
376-396YQNPNKKKVSCDPKSHPTKDYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, nucl 8, mito 3, pero 2, vacu 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR013320  ConA-like_dom_sf  
IPR000757  GH16  
IPR005629  Skn1/Kre6/Sbg1  
Gene Ontology GO:0016020  C:membrane  
GO:0004553  F:hydrolase activity, hydrolyzing O-glycosyl compounds  
GO:0005975  P:carbohydrate metabolic process  
Pfam View protein in Pfam  
PF03935  SKN1_KRE6_Sbg1  
PROSITE View protein in PROSITE  
PS51762  GH16_2  
Amino Acid Sequences MHQKNAGVAESANSPIDRSIPRRSSELIDPNTPNDVRTMMSTKGEELQLVFSDEFDENGRKFGKGQDPFWEAVDLWYEPTGDLEYYHPDQVTTKDGNMVITLERKAVGELEFSSGMVQSWNKFCFQGGRLEVKVRLPGDPLVEGLWPGAWTLGNLGRAGYKATTDGVWPYSYDSCDNAVKANQSLTNGLSHLPGQRLNACVCTGDHPNPGHGRGAPEIDLIEATSHHSGAEVSQSLQVAPFDEGRQFKASDTKVSNGKTKQNDYLGSPLQQSISALTRLDEKIFEKRGGEFQTFSIEYDYEDDGYITWFVGKEETWTVNAGAIGANPASKVADRKIPEEPMYIILNLALSKSFAKGLDTNKLELPSEYLIDYVRLYQNPNKKKVSCDPKSHPTKDYIENHPKAYYNKNFTSWKGAGYSLPQYTVSDKKC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.14
3 0.19
4 0.23
5 0.26
6 0.34
7 0.39
8 0.41
9 0.45
10 0.47
11 0.47
12 0.51
13 0.55
14 0.5
15 0.51
16 0.51
17 0.49
18 0.52
19 0.47
20 0.38
21 0.3
22 0.26
23 0.2
24 0.22
25 0.24
26 0.2
27 0.24
28 0.24
29 0.24
30 0.27
31 0.27
32 0.23
33 0.2
34 0.19
35 0.17
36 0.19
37 0.17
38 0.13
39 0.16
40 0.15
41 0.15
42 0.15
43 0.19
44 0.16
45 0.2
46 0.21
47 0.19
48 0.2
49 0.27
50 0.34
51 0.35
52 0.38
53 0.41
54 0.44
55 0.45
56 0.45
57 0.39
58 0.29
59 0.24
60 0.25
61 0.17
62 0.14
63 0.13
64 0.12
65 0.11
66 0.11
67 0.11
68 0.09
69 0.09
70 0.1
71 0.15
72 0.17
73 0.18
74 0.17
75 0.17
76 0.18
77 0.19
78 0.23
79 0.2
80 0.18
81 0.2
82 0.2
83 0.2
84 0.19
85 0.18
86 0.14
87 0.16
88 0.16
89 0.13
90 0.13
91 0.13
92 0.13
93 0.13
94 0.12
95 0.1
96 0.11
97 0.13
98 0.12
99 0.12
100 0.12
101 0.11
102 0.1
103 0.1
104 0.11
105 0.1
106 0.15
107 0.16
108 0.17
109 0.17
110 0.17
111 0.21
112 0.21
113 0.26
114 0.26
115 0.3
116 0.31
117 0.34
118 0.35
119 0.31
120 0.34
121 0.27
122 0.23
123 0.2
124 0.2
125 0.19
126 0.17
127 0.16
128 0.12
129 0.12
130 0.11
131 0.09
132 0.07
133 0.06
134 0.05
135 0.05
136 0.04
137 0.04
138 0.06
139 0.09
140 0.1
141 0.1
142 0.1
143 0.1
144 0.1
145 0.12
146 0.1
147 0.08
148 0.07
149 0.08
150 0.08
151 0.08
152 0.09
153 0.09
154 0.1
155 0.09
156 0.11
157 0.12
158 0.12
159 0.13
160 0.12
161 0.14
162 0.14
163 0.14
164 0.13
165 0.14
166 0.14
167 0.13
168 0.14
169 0.12
170 0.12
171 0.13
172 0.12
173 0.12
174 0.11
175 0.11
176 0.1
177 0.1
178 0.11
179 0.11
180 0.12
181 0.12
182 0.14
183 0.15
184 0.15
185 0.15
186 0.13
187 0.13
188 0.12
189 0.13
190 0.15
191 0.15
192 0.19
193 0.18
194 0.21
195 0.22
196 0.22
197 0.21
198 0.18
199 0.18
200 0.14
201 0.15
202 0.12
203 0.11
204 0.1
205 0.09
206 0.08
207 0.06
208 0.05
209 0.04
210 0.06
211 0.06
212 0.06
213 0.06
214 0.06
215 0.06
216 0.06
217 0.08
218 0.06
219 0.07
220 0.08
221 0.08
222 0.08
223 0.09
224 0.08
225 0.07
226 0.08
227 0.08
228 0.08
229 0.11
230 0.12
231 0.14
232 0.16
233 0.16
234 0.15
235 0.21
236 0.21
237 0.24
238 0.25
239 0.26
240 0.3
241 0.32
242 0.37
243 0.34
244 0.41
245 0.4
246 0.42
247 0.43
248 0.42
249 0.41
250 0.36
251 0.38
252 0.32
253 0.28
254 0.25
255 0.22
256 0.18
257 0.17
258 0.15
259 0.11
260 0.11
261 0.11
262 0.1
263 0.1
264 0.13
265 0.14
266 0.15
267 0.15
268 0.15
269 0.21
270 0.24
271 0.25
272 0.22
273 0.23
274 0.28
275 0.3
276 0.3
277 0.24
278 0.21
279 0.26
280 0.25
281 0.24
282 0.19
283 0.15
284 0.14
285 0.16
286 0.16
287 0.11
288 0.1
289 0.1
290 0.08
291 0.09
292 0.09
293 0.06
294 0.06
295 0.06
296 0.06
297 0.07
298 0.07
299 0.09
300 0.11
301 0.13
302 0.13
303 0.14
304 0.14
305 0.14
306 0.14
307 0.12
308 0.09
309 0.08
310 0.08
311 0.07
312 0.07
313 0.06
314 0.06
315 0.07
316 0.08
317 0.11
318 0.12
319 0.19
320 0.21
321 0.25
322 0.3
323 0.34
324 0.34
325 0.34
326 0.32
327 0.29
328 0.28
329 0.25
330 0.2
331 0.15
332 0.14
333 0.12
334 0.1
335 0.07
336 0.07
337 0.07
338 0.09
339 0.1
340 0.1
341 0.13
342 0.18
343 0.22
344 0.3
345 0.32
346 0.33
347 0.34
348 0.35
349 0.33
350 0.28
351 0.28
352 0.2
353 0.19
354 0.16
355 0.14
356 0.13
357 0.13
358 0.14
359 0.14
360 0.17
361 0.17
362 0.22
363 0.29
364 0.38
365 0.47
366 0.54
367 0.58
368 0.57
369 0.63
370 0.68
371 0.72
372 0.71
373 0.72
374 0.73
375 0.76
376 0.84
377 0.81
378 0.74
379 0.69
380 0.67
381 0.66
382 0.64
383 0.64
384 0.65
385 0.64
386 0.63
387 0.59
388 0.57
389 0.53
390 0.56
391 0.55
392 0.52
393 0.53
394 0.57
395 0.59
396 0.57
397 0.61
398 0.52
399 0.46
400 0.4
401 0.37
402 0.32
403 0.33
404 0.36
405 0.29
406 0.3
407 0.28
408 0.27
409 0.31