Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137PDX4

Protein Details
Accession A0A137PDX4   
Localization Confidence Medium
Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
11-40ANKTCAAKTLNKKPCKNKKKSGSEYCTRHDHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto_nucl 13, cyto 2
Family & Domain DBs
Amino Acid Sequences MAEDSQSKAIANKTCAAKTLNKKPCKNKKKSGSEYCTRHDKKYARKEVSGEVDLCSIGECTTKFSKKAEQYLNIIIVNKDNFEDIINHGVADKDKISFGQQDLSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.35
3 0.36
4 0.39
5 0.44
6 0.52
7 0.55
8 0.6
9 0.68
10 0.76
11 0.84
12 0.86
13 0.87
14 0.86
15 0.87
16 0.89
17 0.91
18 0.91
19 0.87
20 0.86
21 0.81
22 0.76
23 0.76
24 0.67
25 0.59
26 0.57
27 0.55
28 0.56
29 0.62
30 0.67
31 0.6
32 0.6
33 0.6
34 0.56
35 0.55
36 0.46
37 0.36
38 0.26
39 0.22
40 0.19
41 0.17
42 0.12
43 0.07
44 0.05
45 0.06
46 0.05
47 0.09
48 0.14
49 0.16
50 0.17
51 0.19
52 0.27
53 0.31
54 0.39
55 0.41
56 0.4
57 0.42
58 0.44
59 0.45
60 0.38
61 0.34
62 0.26
63 0.23
64 0.2
65 0.16
66 0.13
67 0.11
68 0.11
69 0.11
70 0.12
71 0.11
72 0.15
73 0.14
74 0.14
75 0.14
76 0.15
77 0.14
78 0.16
79 0.14
80 0.11
81 0.12
82 0.13
83 0.16
84 0.19
85 0.19