Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137NZ29

Protein Details
Accession A0A137NZ29    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
21-40WKMSSCRKANLRKRLRDVDEHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MLGPFRASLTALGGLVWKNPWKMSSCRKANLRKRLRDVDEVVKTLSDSGYTCKRLEEFKKLPTEAELSPREKYTVFSKSTKGHRLVIHKVPKFTKLPHPRKSPIGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.14
4 0.15
5 0.15
6 0.16
7 0.18
8 0.21
9 0.28
10 0.37
11 0.45
12 0.49
13 0.55
14 0.62
15 0.71
16 0.76
17 0.8
18 0.8
19 0.78
20 0.79
21 0.81
22 0.77
23 0.72
24 0.67
25 0.65
26 0.58
27 0.5
28 0.42
29 0.33
30 0.28
31 0.22
32 0.17
33 0.09
34 0.06
35 0.08
36 0.13
37 0.15
38 0.16
39 0.16
40 0.17
41 0.22
42 0.26
43 0.32
44 0.31
45 0.34
46 0.39
47 0.39
48 0.38
49 0.34
50 0.34
51 0.25
52 0.29
53 0.27
54 0.25
55 0.26
56 0.26
57 0.25
58 0.22
59 0.23
60 0.22
61 0.24
62 0.26
63 0.28
64 0.32
65 0.37
66 0.45
67 0.5
68 0.48
69 0.47
70 0.49
71 0.53
72 0.56
73 0.59
74 0.62
75 0.58
76 0.61
77 0.58
78 0.59
79 0.56
80 0.54
81 0.55
82 0.56
83 0.63
84 0.66
85 0.72
86 0.72