Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A137PFD0

Protein Details
Accession A0A137PFD0    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MKQKPKTKSSKSKTPASTNNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR003746  DUF167  
IPR036591  YggU-like_sf  
Pfam View protein in Pfam  
PF02594  DUF167  
Amino Acid Sequences MKQKPKTKSSKSKTPASTNNTIDFNNNPSIPNYLKYLPNNKININLKIKPNAQMSQILQIVEDRVEVQVAAPPRDGEANEALVKCMARFLNLKKSQVSLVSGHKSVLKVIQLEDYNSPPETLINCILNQTKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.76
4 0.75
5 0.68
6 0.66
7 0.58
8 0.51
9 0.44
10 0.36
11 0.33
12 0.28
13 0.25
14 0.22
15 0.21
16 0.24
17 0.23
18 0.23
19 0.23
20 0.21
21 0.26
22 0.3
23 0.37
24 0.39
25 0.45
26 0.46
27 0.43
28 0.48
29 0.48
30 0.5
31 0.49
32 0.48
33 0.44
34 0.46
35 0.47
36 0.44
37 0.43
38 0.37
39 0.33
40 0.32
41 0.29
42 0.29
43 0.28
44 0.23
45 0.18
46 0.17
47 0.15
48 0.11
49 0.1
50 0.06
51 0.04
52 0.04
53 0.04
54 0.04
55 0.06
56 0.07
57 0.08
58 0.08
59 0.08
60 0.08
61 0.09
62 0.09
63 0.09
64 0.09
65 0.11
66 0.13
67 0.13
68 0.13
69 0.12
70 0.12
71 0.1
72 0.12
73 0.1
74 0.1
75 0.14
76 0.18
77 0.29
78 0.33
79 0.36
80 0.33
81 0.35
82 0.34
83 0.32
84 0.31
85 0.24
86 0.26
87 0.28
88 0.27
89 0.26
90 0.27
91 0.25
92 0.24
93 0.24
94 0.2
95 0.17
96 0.18
97 0.23
98 0.22
99 0.24
100 0.25
101 0.24
102 0.24
103 0.23
104 0.23
105 0.17
106 0.18
107 0.17
108 0.18
109 0.2
110 0.19
111 0.19
112 0.23