Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P3E3

Protein Details
Accession A0A137P3E3   
Localization Confidence High
Confidence Score 18
NoLS Segment(s)
PositionSequenceProtein Nature
8-33EFPSIEPKPPPPKPSKKRPVSGPALPHydrophilic
NLS Segment(s)
PositionSequence
13-26EPKPPPPKPSKKRP
Subcellular Location(s) nucl 26
Family & Domain DBs
InterPro View protein in InterPro  
IPR022226  DUF3752  
IPR046331  GPAM1-like  
Pfam View protein in Pfam  
PF12572  DUF3752  
Amino Acid Sequences MKKDEKREFPSIEPKPPPPKPSKKRPVSGPALPESLYESEHVVSKRKGALPAEDFIGPSFPDKASSAGALNNALPIIEQRHQGKLNKNGDKPKREEWMVVPPTSQLKVDPLNLKNRQFNQSSRVLGNKDLDNSLWTETPQQKYNRIVRGKSEDKKAEEQAEEQAEEQAEEETKESISKVEKRRQQNLEQFVVSYNKEYRGKSLMDEYVSKRGPSSQNKPPDNLKFKADGNREGDILRTLNDMGGLASRFKASSSGKYM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.68
3 0.7
4 0.71
5 0.71
6 0.76
7 0.77
8 0.82
9 0.85
10 0.84
11 0.86
12 0.87
13 0.86
14 0.83
15 0.8
16 0.75
17 0.68
18 0.6
19 0.52
20 0.43
21 0.37
22 0.3
23 0.24
24 0.18
25 0.15
26 0.14
27 0.18
28 0.19
29 0.21
30 0.2
31 0.24
32 0.29
33 0.31
34 0.35
35 0.33
36 0.39
37 0.37
38 0.38
39 0.36
40 0.31
41 0.27
42 0.22
43 0.21
44 0.14
45 0.12
46 0.12
47 0.1
48 0.11
49 0.12
50 0.13
51 0.13
52 0.14
53 0.14
54 0.13
55 0.14
56 0.13
57 0.12
58 0.11
59 0.09
60 0.08
61 0.07
62 0.07
63 0.1
64 0.11
65 0.16
66 0.17
67 0.23
68 0.27
69 0.33
70 0.39
71 0.45
72 0.52
73 0.56
74 0.6
75 0.64
76 0.68
77 0.7
78 0.68
79 0.64
80 0.6
81 0.54
82 0.5
83 0.44
84 0.46
85 0.42
86 0.37
87 0.31
88 0.26
89 0.27
90 0.25
91 0.22
92 0.12
93 0.12
94 0.14
95 0.18
96 0.23
97 0.24
98 0.32
99 0.37
100 0.4
101 0.43
102 0.44
103 0.45
104 0.41
105 0.4
106 0.36
107 0.36
108 0.34
109 0.3
110 0.3
111 0.26
112 0.25
113 0.26
114 0.22
115 0.18
116 0.16
117 0.15
118 0.13
119 0.13
120 0.12
121 0.09
122 0.09
123 0.13
124 0.17
125 0.2
126 0.25
127 0.26
128 0.29
129 0.36
130 0.42
131 0.46
132 0.46
133 0.44
134 0.43
135 0.5
136 0.54
137 0.52
138 0.53
139 0.5
140 0.49
141 0.52
142 0.51
143 0.46
144 0.38
145 0.34
146 0.3
147 0.27
148 0.23
149 0.19
150 0.17
151 0.14
152 0.13
153 0.12
154 0.08
155 0.07
156 0.07
157 0.07
158 0.06
159 0.07
160 0.07
161 0.07
162 0.08
163 0.14
164 0.21
165 0.29
166 0.37
167 0.45
168 0.53
169 0.62
170 0.66
171 0.7
172 0.71
173 0.69
174 0.65
175 0.58
176 0.5
177 0.43
178 0.4
179 0.31
180 0.26
181 0.21
182 0.23
183 0.27
184 0.27
185 0.29
186 0.3
187 0.3
188 0.29
189 0.32
190 0.29
191 0.27
192 0.31
193 0.31
194 0.35
195 0.35
196 0.33
197 0.28
198 0.32
199 0.38
200 0.43
201 0.47
202 0.48
203 0.57
204 0.6
205 0.64
206 0.66
207 0.68
208 0.66
209 0.61
210 0.56
211 0.5
212 0.51
213 0.57
214 0.53
215 0.5
216 0.47
217 0.46
218 0.43
219 0.39
220 0.36
221 0.29
222 0.25
223 0.19
224 0.16
225 0.14
226 0.13
227 0.13
228 0.12
229 0.1
230 0.12
231 0.12
232 0.11
233 0.12
234 0.13
235 0.13
236 0.13
237 0.19
238 0.2