Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P3F7

Protein Details
Accession A0A137P3F7    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
192-216SEYLKRNPKSSRSSRRTRRFEELEKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 13, cyto 8.5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR013950  Mis14/Nsl1  
Gene Ontology GO:0000776  C:kinetochore  
GO:0000070  P:mitotic sister chromatid segregation  
Pfam View protein in Pfam  
PF08641  Mis14  
Amino Acid Sequences MGNEIPKLQLHTQFDFEYIKSNLTTKLNQIFDQFLHPLLSKPTQISDKLLNKKQIKIVKLLTEKCFDHVLEQAKKLESLDHDLLAEVQELMDENDELTLEVTRLRHQYPQAYSKLFNNQSLSTLNLFGINLAGEGALLEDFDNTYNDFGEVKEISEQELDIITKIFDKLNPLTNELKELVAKSEQIQKVVNSEYLKRNPKSSRSSRRTRRFEELEKASYSEVVDNSNNAEIGSVDELMFDEAKLKKVKLFRVKFGEVANVPTSD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.3
4 0.29
5 0.24
6 0.23
7 0.21
8 0.22
9 0.24
10 0.26
11 0.29
12 0.29
13 0.36
14 0.37
15 0.37
16 0.38
17 0.35
18 0.32
19 0.34
20 0.28
21 0.21
22 0.21
23 0.2
24 0.19
25 0.21
26 0.23
27 0.21
28 0.21
29 0.24
30 0.26
31 0.27
32 0.3
33 0.34
34 0.4
35 0.48
36 0.53
37 0.58
38 0.58
39 0.61
40 0.65
41 0.62
42 0.55
43 0.53
44 0.51
45 0.5
46 0.55
47 0.55
48 0.51
49 0.5
50 0.48
51 0.43
52 0.41
53 0.32
54 0.26
55 0.25
56 0.3
57 0.29
58 0.31
59 0.31
60 0.29
61 0.3
62 0.28
63 0.26
64 0.19
65 0.22
66 0.21
67 0.19
68 0.18
69 0.18
70 0.18
71 0.15
72 0.14
73 0.06
74 0.05
75 0.04
76 0.04
77 0.05
78 0.05
79 0.04
80 0.04
81 0.04
82 0.04
83 0.04
84 0.05
85 0.04
86 0.04
87 0.06
88 0.07
89 0.09
90 0.12
91 0.13
92 0.16
93 0.19
94 0.25
95 0.28
96 0.33
97 0.34
98 0.34
99 0.34
100 0.33
101 0.39
102 0.35
103 0.33
104 0.29
105 0.26
106 0.25
107 0.25
108 0.24
109 0.16
110 0.15
111 0.12
112 0.1
113 0.09
114 0.08
115 0.07
116 0.05
117 0.04
118 0.03
119 0.03
120 0.02
121 0.02
122 0.03
123 0.02
124 0.02
125 0.02
126 0.02
127 0.03
128 0.04
129 0.04
130 0.04
131 0.05
132 0.05
133 0.05
134 0.06
135 0.05
136 0.07
137 0.07
138 0.07
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.07
145 0.08
146 0.07
147 0.06
148 0.06
149 0.05
150 0.06
151 0.07
152 0.07
153 0.07
154 0.11
155 0.13
156 0.21
157 0.22
158 0.25
159 0.28
160 0.28
161 0.3
162 0.26
163 0.25
164 0.18
165 0.17
166 0.16
167 0.13
168 0.14
169 0.13
170 0.21
171 0.22
172 0.22
173 0.24
174 0.22
175 0.24
176 0.25
177 0.27
178 0.2
179 0.24
180 0.3
181 0.37
182 0.45
183 0.43
184 0.49
185 0.51
186 0.57
187 0.63
188 0.66
189 0.69
190 0.69
191 0.79
192 0.82
193 0.87
194 0.88
195 0.85
196 0.83
197 0.8
198 0.79
199 0.78
200 0.73
201 0.67
202 0.59
203 0.54
204 0.44
205 0.37
206 0.3
207 0.24
208 0.17
209 0.17
210 0.16
211 0.15
212 0.17
213 0.17
214 0.16
215 0.13
216 0.12
217 0.09
218 0.1
219 0.11
220 0.1
221 0.08
222 0.09
223 0.09
224 0.1
225 0.1
226 0.08
227 0.12
228 0.13
229 0.19
230 0.22
231 0.23
232 0.27
233 0.33
234 0.43
235 0.49
236 0.54
237 0.58
238 0.63
239 0.66
240 0.64
241 0.6
242 0.58
243 0.48
244 0.47