Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NPH2

Protein Details
Accession A0A137NPH2    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-38QGNNNNRNHRHNRGGNRHMNRYEHydrophilic
55-76IIYNGPRRHHRNHGHRRCETSKBasic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 8, cyto 3, vacu 3, extr 2
Family & Domain DBs
Amino Acid Sequences MKYLLALTVLALVQAQGNNNNRNHRHNRGGNRHMNRYENNGPPPQYIMNNGGPEIIYNGPRRHHRNHGHRRCETSKFDDILGYTYDSSEHKFTKGDKSFTRNIAKEVKKVVWIKVCAPKKDLPERKAGTLYVKTDDDNKVLEVSCGGYKESDIVCKDDYSGGEVTIEEGYKDKDDYKDDYKDDYKDDYKDDDYKEDYKDDYKDDDKDYKEDDKDYKEEVREEEEDYPADDDYSGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.16
4 0.23
5 0.3
6 0.35
7 0.45
8 0.47
9 0.56
10 0.62
11 0.63
12 0.67
13 0.7
14 0.76
15 0.77
16 0.82
17 0.83
18 0.82
19 0.83
20 0.78
21 0.75
22 0.67
23 0.64
24 0.62
25 0.59
26 0.57
27 0.53
28 0.5
29 0.45
30 0.45
31 0.39
32 0.33
33 0.3
34 0.29
35 0.28
36 0.27
37 0.26
38 0.23
39 0.2
40 0.19
41 0.19
42 0.15
43 0.15
44 0.19
45 0.21
46 0.26
47 0.33
48 0.4
49 0.43
50 0.51
51 0.57
52 0.64
53 0.73
54 0.79
55 0.81
56 0.8
57 0.82
58 0.77
59 0.73
60 0.67
61 0.63
62 0.58
63 0.5
64 0.45
65 0.38
66 0.33
67 0.28
68 0.23
69 0.17
70 0.11
71 0.1
72 0.1
73 0.1
74 0.12
75 0.13
76 0.13
77 0.13
78 0.14
79 0.16
80 0.26
81 0.3
82 0.33
83 0.34
84 0.39
85 0.43
86 0.48
87 0.53
88 0.43
89 0.42
90 0.46
91 0.45
92 0.42
93 0.41
94 0.35
95 0.35
96 0.36
97 0.36
98 0.31
99 0.31
100 0.32
101 0.37
102 0.41
103 0.36
104 0.38
105 0.38
106 0.39
107 0.48
108 0.51
109 0.45
110 0.5
111 0.5
112 0.48
113 0.46
114 0.4
115 0.34
116 0.29
117 0.28
118 0.22
119 0.21
120 0.19
121 0.21
122 0.22
123 0.19
124 0.16
125 0.15
126 0.13
127 0.13
128 0.12
129 0.09
130 0.09
131 0.09
132 0.09
133 0.09
134 0.07
135 0.07
136 0.1
137 0.1
138 0.13
139 0.13
140 0.15
141 0.16
142 0.16
143 0.16
144 0.15
145 0.15
146 0.14
147 0.13
148 0.11
149 0.1
150 0.1
151 0.11
152 0.1
153 0.1
154 0.07
155 0.07
156 0.08
157 0.09
158 0.1
159 0.12
160 0.14
161 0.17
162 0.22
163 0.28
164 0.32
165 0.33
166 0.38
167 0.39
168 0.38
169 0.37
170 0.38
171 0.36
172 0.32
173 0.33
174 0.31
175 0.32
176 0.35
177 0.34
178 0.32
179 0.33
180 0.34
181 0.34
182 0.32
183 0.3
184 0.29
185 0.29
186 0.28
187 0.29
188 0.3
189 0.32
190 0.36
191 0.4
192 0.39
193 0.4
194 0.42
195 0.43
196 0.41
197 0.43
198 0.43
199 0.42
200 0.42
201 0.43
202 0.44
203 0.41
204 0.42
205 0.39
206 0.4
207 0.36
208 0.36
209 0.34
210 0.3
211 0.27
212 0.25
213 0.24
214 0.18
215 0.16
216 0.13