Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137P2L2

Protein Details
Accession A0A137P2L2    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
121-142ADSDRIKRERKQAKANRFKYGGHydrophilic
NLS Segment(s)
PositionSequence
129-131ERK
Subcellular Location(s) nucl 20, cyto_nucl 12.833, cyto_mito 4.166, mito 3.5, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013809  ENTH  
IPR008942  ENTH_VHS  
Pfam View protein in Pfam  
PF01417  ENTH  
PROSITE View protein in PROSITE  
PS50942  ENTH  
Amino Acid Sequences NVTETEAKVLEATNDDGWCSSSSLMLEIAQATFSFPLFNEVMGVISKNFEERDRRTWRQIYKTLTLLEYLIKNGSERVVDYARNSSYFLKSLKNYRYVDSKGKDQGINIRNRSKEILELLADSDRIKRERKQAKANRFKYGGM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.15
4 0.17
5 0.16
6 0.15
7 0.12
8 0.1
9 0.11
10 0.11
11 0.11
12 0.1
13 0.09
14 0.09
15 0.09
16 0.08
17 0.07
18 0.07
19 0.07
20 0.06
21 0.06
22 0.06
23 0.1
24 0.1
25 0.1
26 0.09
27 0.09
28 0.1
29 0.1
30 0.1
31 0.06
32 0.07
33 0.07
34 0.08
35 0.08
36 0.11
37 0.17
38 0.2
39 0.29
40 0.38
41 0.42
42 0.47
43 0.53
44 0.57
45 0.58
46 0.6
47 0.57
48 0.51
49 0.5
50 0.44
51 0.37
52 0.31
53 0.24
54 0.19
55 0.14
56 0.11
57 0.09
58 0.08
59 0.08
60 0.07
61 0.08
62 0.06
63 0.06
64 0.09
65 0.1
66 0.11
67 0.12
68 0.15
69 0.15
70 0.16
71 0.17
72 0.16
73 0.16
74 0.18
75 0.18
76 0.19
77 0.21
78 0.28
79 0.31
80 0.37
81 0.37
82 0.37
83 0.42
84 0.42
85 0.48
86 0.44
87 0.45
88 0.43
89 0.45
90 0.43
91 0.38
92 0.43
93 0.42
94 0.48
95 0.47
96 0.49
97 0.46
98 0.48
99 0.49
100 0.41
101 0.37
102 0.31
103 0.28
104 0.23
105 0.22
106 0.21
107 0.19
108 0.19
109 0.16
110 0.17
111 0.18
112 0.21
113 0.25
114 0.3
115 0.39
116 0.49
117 0.57
118 0.65
119 0.7
120 0.79
121 0.85
122 0.84
123 0.83