Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A137NQS1

Protein Details
Accession A0A137NQS1    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
139-160GPEHWRVKGNRNKDTKNKQEAEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 14.5, cyto 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR022816  Condensin_barren_su2  
Gene Ontology GO:0000796  C:condensin complex  
GO:0005737  C:cytoplasm  
GO:0051301  P:cell division  
GO:0007076  P:mitotic chromosome condensation  
Pfam View protein in Pfam  
PF05786  Cnd2  
Amino Acid Sequences MSLPGSSCEKHRMSIGELPSTSADFDEGGARELLLKHLSIQGDGRMIFDSGDAAITEDGSVPVQPLVTESVDRDFLELDSLTYLIFNQDSPHTTLDFNNLKPNEISDNKDDDYVLQNEKSLIRDDGPVGDKSNYPGWAGPEHWRVKGNRNKDTKNKQEAELRLNPSQSLRRVNL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.37
4 0.36
5 0.36
6 0.33
7 0.3
8 0.25
9 0.19
10 0.15
11 0.09
12 0.1
13 0.11
14 0.1
15 0.11
16 0.11
17 0.11
18 0.12
19 0.12
20 0.14
21 0.11
22 0.11
23 0.11
24 0.15
25 0.15
26 0.14
27 0.15
28 0.14
29 0.16
30 0.16
31 0.15
32 0.12
33 0.12
34 0.11
35 0.1
36 0.09
37 0.06
38 0.06
39 0.05
40 0.05
41 0.05
42 0.05
43 0.05
44 0.05
45 0.05
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.04
52 0.05
53 0.07
54 0.07
55 0.08
56 0.08
57 0.09
58 0.11
59 0.11
60 0.1
61 0.08
62 0.08
63 0.09
64 0.08
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.05
71 0.04
72 0.04
73 0.04
74 0.05
75 0.06
76 0.07
77 0.09
78 0.1
79 0.11
80 0.12
81 0.12
82 0.18
83 0.2
84 0.19
85 0.24
86 0.23
87 0.23
88 0.23
89 0.24
90 0.23
91 0.22
92 0.25
93 0.21
94 0.25
95 0.24
96 0.25
97 0.23
98 0.19
99 0.2
100 0.19
101 0.18
102 0.14
103 0.14
104 0.15
105 0.16
106 0.17
107 0.15
108 0.14
109 0.13
110 0.14
111 0.14
112 0.17
113 0.19
114 0.19
115 0.19
116 0.19
117 0.19
118 0.2
119 0.23
120 0.2
121 0.18
122 0.19
123 0.19
124 0.2
125 0.22
126 0.26
127 0.31
128 0.33
129 0.34
130 0.38
131 0.38
132 0.46
133 0.52
134 0.54
135 0.55
136 0.62
137 0.68
138 0.73
139 0.81
140 0.82
141 0.84
142 0.78
143 0.74
144 0.74
145 0.71
146 0.69
147 0.66
148 0.62
149 0.55
150 0.53
151 0.49
152 0.46
153 0.47
154 0.44