Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135SAP9

Protein Details
Accession A0A135SAP9    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
5-33SVSRTGACQRCHRRKVKCDRTRPSCAPCSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MPSGSVSRTGACQRCHRRKVKCDRTRPSCAPCSRINLQCTNAAREHQIQLRRQDAERLEQHIRDLQAENDNLTGRLADAQQQQHQPSTEDERLATPTTTSSLGLQIDESEAPTAGSSDIAS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.72
3 0.76
4 0.78
5 0.83
6 0.89
7 0.9
8 0.89
9 0.89
10 0.9
11 0.89
12 0.89
13 0.85
14 0.81
15 0.79
16 0.72
17 0.66
18 0.59
19 0.58
20 0.55
21 0.54
22 0.51
23 0.45
24 0.44
25 0.45
26 0.43
27 0.4
28 0.35
29 0.29
30 0.28
31 0.26
32 0.28
33 0.26
34 0.3
35 0.3
36 0.34
37 0.37
38 0.36
39 0.34
40 0.35
41 0.32
42 0.32
43 0.3
44 0.31
45 0.29
46 0.27
47 0.27
48 0.25
49 0.24
50 0.19
51 0.17
52 0.14
53 0.16
54 0.16
55 0.15
56 0.14
57 0.14
58 0.12
59 0.11
60 0.1
61 0.06
62 0.07
63 0.07
64 0.1
65 0.15
66 0.18
67 0.23
68 0.27
69 0.28
70 0.29
71 0.3
72 0.27
73 0.25
74 0.3
75 0.28
76 0.25
77 0.24
78 0.23
79 0.25
80 0.25
81 0.22
82 0.14
83 0.13
84 0.14
85 0.14
86 0.14
87 0.12
88 0.13
89 0.14
90 0.13
91 0.13
92 0.11
93 0.12
94 0.12
95 0.12
96 0.1
97 0.09
98 0.09
99 0.09
100 0.09
101 0.07