Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135RWB2

Protein Details
Accession A0A135RWB2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
62-91TKNKSTAKAKTKTKTRANTKTKQQDNHEHEHydrophilic
NLS Segment(s)
PositionSequence
31-78REGRAVRPRGGRGRSGSTTARGRGKTSGGRVTKNKSTAKAKTKTKTRA
Subcellular Location(s) mito 24.5, cyto_mito 13
Family & Domain DBs
Amino Acid Sequences MRPRNRGSSTASQAGSVVSVASVSTSKTEGREGRAVRPRGGRGRSGSTTARGRGKTSGGRVTKNKSTAKAKTKTKTRANTKTKQQDNHEHEDGDFMA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.28
3 0.19
4 0.12
5 0.05
6 0.05
7 0.04
8 0.05
9 0.05
10 0.05
11 0.06
12 0.08
13 0.09
14 0.1
15 0.16
16 0.17
17 0.21
18 0.28
19 0.29
20 0.36
21 0.43
22 0.45
23 0.43
24 0.45
25 0.46
26 0.47
27 0.48
28 0.43
29 0.38
30 0.42
31 0.39
32 0.38
33 0.34
34 0.31
35 0.31
36 0.31
37 0.32
38 0.27
39 0.27
40 0.25
41 0.27
42 0.27
43 0.28
44 0.33
45 0.31
46 0.36
47 0.39
48 0.43
49 0.45
50 0.49
51 0.48
52 0.46
53 0.51
54 0.54
55 0.6
56 0.62
57 0.66
58 0.68
59 0.74
60 0.77
61 0.79
62 0.8
63 0.81
64 0.84
65 0.84
66 0.84
67 0.85
68 0.86
69 0.85
70 0.83
71 0.8
72 0.8
73 0.79
74 0.78
75 0.71
76 0.61
77 0.53