Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135V9G2

Protein Details
Accession A0A135V9G2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
348-379LEQPLSRNTGKSKKNKKKKKPTKKAAAAGGEEHydrophilic
NLS Segment(s)
PositionSequence
357-373GKSKKNKKKKKPTKKAA
Subcellular Location(s) cyto 18, cyto_nucl 14.833, nucl 7.5, mito_nucl 5.332
Family & Domain DBs
InterPro View protein in InterPro  
IPR036005  Creatinase/aminopeptidase-like  
IPR047113  PA2G4/ARX1  
IPR036388  WH-like_DNA-bd_sf  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:0003677  F:DNA binding  
CDD cd01089  PA2G4-like  
Amino Acid Sequences MSEEIDYSLNNPDTLTKYKTAAQISEKVLAAVAELIKPGEKIVTICEKGFSHPTTISPASFVTPYTPLTTDEAEAGAEIKEGEPIKIQLGAQIDGFGSIVCDTVVAGEITGRTADLVLANYYANELLLRLMLPPGLLASGTDEEKAKAAATKAPTQAKITSLLEKVVKSYDCNLVESTTSWLFERNEIEGKKKIVLAPAEGTRGDGTPEIGEVWGVEMGVSLGAGKVKTLDSRTTLHRRTTTNYGLKRPTSRKILSEVQKKFGTFPFSLRQLDDERDAKSGVVECVRGNVFRAYEVVGDKDNSPVARYLSTIAITKNGITKLGAPPALDLEKVKSDKKIEDEEVLKILEQPLSRNTGKSKKNKKKKKPTKKAAAAGGEEEEESDEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.31
3 0.28
4 0.29
5 0.34
6 0.4
7 0.41
8 0.41
9 0.42
10 0.45
11 0.45
12 0.48
13 0.43
14 0.36
15 0.33
16 0.27
17 0.21
18 0.17
19 0.14
20 0.1
21 0.1
22 0.1
23 0.11
24 0.11
25 0.11
26 0.09
27 0.09
28 0.09
29 0.14
30 0.23
31 0.24
32 0.25
33 0.28
34 0.28
35 0.3
36 0.36
37 0.32
38 0.27
39 0.26
40 0.27
41 0.31
42 0.32
43 0.28
44 0.24
45 0.23
46 0.21
47 0.2
48 0.19
49 0.14
50 0.15
51 0.16
52 0.17
53 0.17
54 0.17
55 0.2
56 0.21
57 0.19
58 0.17
59 0.16
60 0.13
61 0.12
62 0.11
63 0.08
64 0.06
65 0.06
66 0.05
67 0.09
68 0.1
69 0.1
70 0.11
71 0.12
72 0.13
73 0.15
74 0.15
75 0.14
76 0.16
77 0.16
78 0.14
79 0.14
80 0.13
81 0.11
82 0.11
83 0.08
84 0.06
85 0.05
86 0.05
87 0.04
88 0.04
89 0.04
90 0.04
91 0.05
92 0.04
93 0.04
94 0.05
95 0.05
96 0.05
97 0.06
98 0.05
99 0.04
100 0.04
101 0.05
102 0.05
103 0.06
104 0.06
105 0.07
106 0.07
107 0.07
108 0.07
109 0.07
110 0.06
111 0.05
112 0.05
113 0.04
114 0.04
115 0.05
116 0.05
117 0.05
118 0.05
119 0.05
120 0.05
121 0.04
122 0.04
123 0.04
124 0.04
125 0.06
126 0.07
127 0.08
128 0.09
129 0.09
130 0.09
131 0.1
132 0.1
133 0.08
134 0.08
135 0.09
136 0.12
137 0.15
138 0.2
139 0.25
140 0.28
141 0.29
142 0.3
143 0.3
144 0.27
145 0.28
146 0.25
147 0.23
148 0.2
149 0.21
150 0.21
151 0.19
152 0.19
153 0.18
154 0.16
155 0.14
156 0.16
157 0.2
158 0.19
159 0.2
160 0.2
161 0.18
162 0.18
163 0.17
164 0.18
165 0.11
166 0.11
167 0.1
168 0.12
169 0.12
170 0.14
171 0.14
172 0.13
173 0.18
174 0.18
175 0.22
176 0.22
177 0.22
178 0.22
179 0.22
180 0.21
181 0.19
182 0.19
183 0.17
184 0.17
185 0.17
186 0.17
187 0.16
188 0.16
189 0.13
190 0.12
191 0.11
192 0.08
193 0.07
194 0.06
195 0.06
196 0.06
197 0.05
198 0.05
199 0.04
200 0.04
201 0.04
202 0.04
203 0.03
204 0.03
205 0.03
206 0.03
207 0.03
208 0.02
209 0.03
210 0.04
211 0.04
212 0.04
213 0.05
214 0.06
215 0.08
216 0.1
217 0.12
218 0.14
219 0.17
220 0.24
221 0.32
222 0.36
223 0.38
224 0.41
225 0.41
226 0.43
227 0.48
228 0.49
229 0.49
230 0.5
231 0.51
232 0.51
233 0.52
234 0.56
235 0.54
236 0.51
237 0.52
238 0.5
239 0.46
240 0.47
241 0.53
242 0.53
243 0.58
244 0.55
245 0.52
246 0.52
247 0.5
248 0.46
249 0.41
250 0.37
251 0.28
252 0.29
253 0.29
254 0.32
255 0.33
256 0.31
257 0.31
258 0.28
259 0.29
260 0.3
261 0.27
262 0.24
263 0.24
264 0.23
265 0.2
266 0.18
267 0.18
268 0.15
269 0.14
270 0.14
271 0.13
272 0.16
273 0.17
274 0.16
275 0.16
276 0.17
277 0.15
278 0.15
279 0.16
280 0.13
281 0.14
282 0.15
283 0.15
284 0.14
285 0.15
286 0.15
287 0.16
288 0.17
289 0.15
290 0.15
291 0.15
292 0.16
293 0.15
294 0.15
295 0.16
296 0.15
297 0.17
298 0.17
299 0.16
300 0.16
301 0.16
302 0.17
303 0.19
304 0.18
305 0.17
306 0.16
307 0.19
308 0.21
309 0.26
310 0.27
311 0.22
312 0.22
313 0.26
314 0.26
315 0.23
316 0.2
317 0.18
318 0.24
319 0.27
320 0.29
321 0.3
322 0.33
323 0.37
324 0.41
325 0.45
326 0.41
327 0.45
328 0.45
329 0.42
330 0.4
331 0.35
332 0.3
333 0.24
334 0.23
335 0.19
336 0.18
337 0.18
338 0.2
339 0.26
340 0.27
341 0.29
342 0.36
343 0.42
344 0.5
345 0.58
346 0.66
347 0.71
348 0.81
349 0.88
350 0.92
351 0.94
352 0.96
353 0.97
354 0.97
355 0.97
356 0.97
357 0.97
358 0.94
359 0.91
360 0.87
361 0.79
362 0.7
363 0.61
364 0.5
365 0.39
366 0.31