Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3JUU4

Protein Details
Accession G3JUU4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
8-27DRLFGARKGRRRTTNPRVGDBasic
NLS Segment(s)
Subcellular Location(s) mito 24, plas 1, extr 1, E.R. 1
Family & Domain DBs
KEGG cmt:CCM_09585  -  
Amino Acid Sequences MVPGQYLDRLFGARKGRRRTTNPRVGDPLHGSKQSENELGLLHAIKCQVLAIIRITVLSSGRHTDRRLVTGSWLGMRGELGFVPTAIRYPKLFLDYVDSWLDPPSFAICHGPLRRSLSYDGVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.51
3 0.59
4 0.66
5 0.74
6 0.79
7 0.8
8 0.83
9 0.79
10 0.76
11 0.72
12 0.65
13 0.61
14 0.57
15 0.53
16 0.47
17 0.44
18 0.39
19 0.35
20 0.36
21 0.34
22 0.29
23 0.22
24 0.18
25 0.16
26 0.15
27 0.14
28 0.12
29 0.09
30 0.08
31 0.08
32 0.07
33 0.07
34 0.07
35 0.07
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.07
44 0.07
45 0.07
46 0.07
47 0.09
48 0.11
49 0.14
50 0.15
51 0.2
52 0.2
53 0.22
54 0.23
55 0.21
56 0.21
57 0.21
58 0.21
59 0.16
60 0.15
61 0.13
62 0.11
63 0.1
64 0.09
65 0.07
66 0.06
67 0.06
68 0.05
69 0.05
70 0.06
71 0.06
72 0.08
73 0.08
74 0.1
75 0.1
76 0.12
77 0.14
78 0.17
79 0.17
80 0.16
81 0.22
82 0.22
83 0.25
84 0.24
85 0.22
86 0.19
87 0.21
88 0.2
89 0.13
90 0.13
91 0.11
92 0.1
93 0.11
94 0.14
95 0.14
96 0.23
97 0.26
98 0.28
99 0.31
100 0.38
101 0.39
102 0.39
103 0.41