Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135V0I0

Protein Details
Accession A0A135V0I0    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
71-93VAAAPYRRTRQRRRTYHGTSHTSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 9, plas 7, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Amino Acid Sequences MLFMASKFTPPHPSDPFPVPLGCSRVSHLPSRDSKVWCVRFSQSVIPSLIAGLGSLVALGPGPSRLAVAVVAAAPYRRTRQRRRTYHGTSHTSGLPRGDYSFSPPVPPEPPLPGSERGSGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.47
3 0.48
4 0.41
5 0.39
6 0.34
7 0.31
8 0.3
9 0.27
10 0.23
11 0.22
12 0.27
13 0.29
14 0.32
15 0.31
16 0.35
17 0.38
18 0.44
19 0.47
20 0.43
21 0.47
22 0.5
23 0.53
24 0.47
25 0.45
26 0.41
27 0.38
28 0.38
29 0.38
30 0.3
31 0.27
32 0.27
33 0.24
34 0.21
35 0.18
36 0.15
37 0.09
38 0.07
39 0.04
40 0.03
41 0.03
42 0.02
43 0.02
44 0.02
45 0.02
46 0.02
47 0.02
48 0.03
49 0.03
50 0.03
51 0.03
52 0.03
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.05
62 0.07
63 0.12
64 0.2
65 0.29
66 0.4
67 0.51
68 0.61
69 0.7
70 0.77
71 0.83
72 0.83
73 0.84
74 0.83
75 0.79
76 0.7
77 0.63
78 0.57
79 0.49
80 0.42
81 0.33
82 0.26
83 0.2
84 0.2
85 0.19
86 0.16
87 0.21
88 0.26
89 0.25
90 0.26
91 0.26
92 0.28
93 0.29
94 0.31
95 0.27
96 0.27
97 0.29
98 0.29
99 0.33
100 0.34
101 0.35