Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135SHM5

Protein Details
Accession A0A135SHM5   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
114-142PTECLPRKRPLKTRFRIRRLSRSQRSPQSHydrophilic
NLS Segment(s)
PositionSequence
120-134RKRPLKTRFRIRRLS
Subcellular Location(s) mito 12, nucl 11.5, cyto_nucl 7.5, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MHVCTLPQSPVHIVGGQRRSAWYHGLPRWRPSKVISSRPATPLRQGLPVRSLKRSQRPQSQAMARTSQDGGDQRLKSFDVDEKLLEEKASLVEVSELEVRPLLDPDEEYLSSSPTECLPRKRPLKTRFRIRRLSRSQRSPQSSESKASEEDSPSSSRNKKQSLGTRKSQSEDASENQRGSSMDSMVYHIAIGLTWSMPAPFDMMPTGYPTRLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.33
4 0.32
5 0.31
6 0.32
7 0.32
8 0.34
9 0.32
10 0.35
11 0.39
12 0.48
13 0.51
14 0.55
15 0.6
16 0.57
17 0.54
18 0.49
19 0.53
20 0.51
21 0.57
22 0.57
23 0.54
24 0.57
25 0.61
26 0.63
27 0.54
28 0.5
29 0.47
30 0.42
31 0.45
32 0.42
33 0.38
34 0.4
35 0.46
36 0.45
37 0.43
38 0.48
39 0.48
40 0.57
41 0.65
42 0.66
43 0.68
44 0.71
45 0.7
46 0.72
47 0.71
48 0.67
49 0.6
50 0.55
51 0.45
52 0.42
53 0.37
54 0.29
55 0.25
56 0.21
57 0.22
58 0.25
59 0.25
60 0.23
61 0.24
62 0.24
63 0.21
64 0.21
65 0.2
66 0.16
67 0.16
68 0.16
69 0.16
70 0.17
71 0.16
72 0.15
73 0.11
74 0.08
75 0.07
76 0.08
77 0.06
78 0.05
79 0.05
80 0.05
81 0.06
82 0.08
83 0.07
84 0.07
85 0.08
86 0.08
87 0.08
88 0.08
89 0.07
90 0.05
91 0.05
92 0.06
93 0.09
94 0.08
95 0.09
96 0.09
97 0.09
98 0.09
99 0.09
100 0.08
101 0.08
102 0.13
103 0.15
104 0.21
105 0.26
106 0.35
107 0.42
108 0.49
109 0.58
110 0.62
111 0.71
112 0.74
113 0.79
114 0.81
115 0.82
116 0.85
117 0.82
118 0.83
119 0.82
120 0.84
121 0.81
122 0.8
123 0.8
124 0.79
125 0.79
126 0.72
127 0.67
128 0.64
129 0.58
130 0.53
131 0.46
132 0.39
133 0.34
134 0.32
135 0.28
136 0.23
137 0.22
138 0.21
139 0.21
140 0.2
141 0.26
142 0.29
143 0.33
144 0.39
145 0.42
146 0.44
147 0.5
148 0.59
149 0.63
150 0.65
151 0.67
152 0.68
153 0.66
154 0.65
155 0.6
156 0.52
157 0.46
158 0.43
159 0.38
160 0.38
161 0.38
162 0.35
163 0.31
164 0.31
165 0.26
166 0.25
167 0.23
168 0.16
169 0.15
170 0.15
171 0.17
172 0.16
173 0.16
174 0.12
175 0.1
176 0.09
177 0.07
178 0.07
179 0.06
180 0.05
181 0.06
182 0.06
183 0.06
184 0.07
185 0.07
186 0.09
187 0.08
188 0.1
189 0.11
190 0.12
191 0.12
192 0.17
193 0.2