Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135TR59

Protein Details
Accession A0A135TR59    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
116-149AESSRPPGKAAKNKKKKRGKGKGQEPKPDLRKRTBasic
NLS Segment(s)
PositionSequence
120-148RPPGKAAKNKKKKRGKGKGQEPKPDLRKR
Subcellular Location(s) nucl 14, cyto_nucl 13.5, cyto 11
Family & Domain DBs
InterPro View protein in InterPro  
IPR024526  DUF3807  
Pfam View protein in Pfam  
PF12720  DUF3807  
Amino Acid Sequences MPPFAAPSVSNDDLVAFFEAHFSGAAVHNFQADFLNPNYQPDAAITNASVQENGDVVEEEDDLGYYHDGVKRTLTDDQIAMFRHSELETIKREQERRSTAVRQAGETGEDGNLTVAESSRPPGKAAKNKKKKRGKGKGQEPKPDLRKRTWDVVESGLDTLDYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.19
3 0.11
4 0.09
5 0.1
6 0.1
7 0.09
8 0.09
9 0.07
10 0.08
11 0.1
12 0.11
13 0.12
14 0.12
15 0.13
16 0.12
17 0.13
18 0.12
19 0.1
20 0.12
21 0.12
22 0.18
23 0.17
24 0.19
25 0.2
26 0.19
27 0.18
28 0.16
29 0.17
30 0.11
31 0.12
32 0.1
33 0.11
34 0.12
35 0.12
36 0.11
37 0.09
38 0.09
39 0.08
40 0.08
41 0.07
42 0.05
43 0.06
44 0.06
45 0.06
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.06
54 0.09
55 0.1
56 0.1
57 0.11
58 0.11
59 0.13
60 0.15
61 0.14
62 0.13
63 0.12
64 0.13
65 0.14
66 0.14
67 0.13
68 0.11
69 0.1
70 0.1
71 0.1
72 0.1
73 0.09
74 0.12
75 0.14
76 0.16
77 0.19
78 0.22
79 0.25
80 0.27
81 0.33
82 0.34
83 0.35
84 0.39
85 0.39
86 0.4
87 0.43
88 0.41
89 0.35
90 0.32
91 0.28
92 0.24
93 0.2
94 0.16
95 0.09
96 0.09
97 0.08
98 0.06
99 0.06
100 0.05
101 0.05
102 0.04
103 0.05
104 0.06
105 0.08
106 0.11
107 0.12
108 0.13
109 0.19
110 0.28
111 0.38
112 0.49
113 0.58
114 0.66
115 0.75
116 0.84
117 0.89
118 0.9
119 0.92
120 0.92
121 0.92
122 0.92
123 0.93
124 0.94
125 0.92
126 0.93
127 0.86
128 0.85
129 0.83
130 0.81
131 0.75
132 0.72
133 0.72
134 0.67
135 0.72
136 0.67
137 0.61
138 0.55
139 0.54
140 0.49
141 0.41
142 0.35
143 0.26