Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135SYH7

Protein Details
Accession A0A135SYH7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
155-182TGRDNLAPKRSWRRRRAGRLELLKVRRFHydrophilic
NLS Segment(s)
PositionSequence
162-175PKRSWRRRRAGRLE
Subcellular Location(s) mito 24, cyto 1, plas 1, E.R. 1
Family & Domain DBs
Amino Acid Sequences MRPAVQAKVFKVSTSRLTGDVQVQVAAAAKLWTAMEDKPMFVLRGTAAAGLVLPWCRRRGYEKSSKGYRRDFHIIMMRTNHYAATYGWILYGWPMGHTESGCEWGSGIQDAKPCPVHASSLCAAMCCVRSTARSARPVQIVRAPVSGISMRTDWTGRDNLAPKRSWRRRRAGRLELLKVRRFGERQFSTVIP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.35
3 0.29
4 0.31
5 0.33
6 0.33
7 0.31
8 0.26
9 0.2
10 0.18
11 0.16
12 0.15
13 0.13
14 0.09
15 0.07
16 0.06
17 0.07
18 0.07
19 0.07
20 0.08
21 0.09
22 0.15
23 0.16
24 0.16
25 0.17
26 0.19
27 0.18
28 0.16
29 0.17
30 0.11
31 0.12
32 0.12
33 0.1
34 0.08
35 0.08
36 0.07
37 0.06
38 0.07
39 0.08
40 0.09
41 0.11
42 0.14
43 0.14
44 0.16
45 0.23
46 0.3
47 0.37
48 0.46
49 0.52
50 0.58
51 0.67
52 0.72
53 0.72
54 0.71
55 0.65
56 0.61
57 0.59
58 0.52
59 0.46
60 0.47
61 0.42
62 0.37
63 0.37
64 0.32
65 0.26
66 0.26
67 0.21
68 0.14
69 0.13
70 0.11
71 0.11
72 0.1
73 0.09
74 0.08
75 0.08
76 0.08
77 0.07
78 0.08
79 0.05
80 0.05
81 0.06
82 0.06
83 0.07
84 0.07
85 0.08
86 0.07
87 0.1
88 0.1
89 0.09
90 0.09
91 0.09
92 0.09
93 0.09
94 0.09
95 0.07
96 0.09
97 0.1
98 0.12
99 0.12
100 0.12
101 0.13
102 0.13
103 0.15
104 0.13
105 0.17
106 0.16
107 0.19
108 0.19
109 0.17
110 0.17
111 0.15
112 0.16
113 0.11
114 0.12
115 0.09
116 0.1
117 0.15
118 0.23
119 0.27
120 0.33
121 0.36
122 0.39
123 0.45
124 0.46
125 0.44
126 0.41
127 0.38
128 0.34
129 0.31
130 0.27
131 0.2
132 0.21
133 0.19
134 0.15
135 0.14
136 0.13
137 0.13
138 0.14
139 0.15
140 0.13
141 0.16
142 0.18
143 0.16
144 0.22
145 0.28
146 0.33
147 0.39
148 0.41
149 0.45
150 0.54
151 0.64
152 0.68
153 0.71
154 0.75
155 0.81
156 0.88
157 0.91
158 0.9
159 0.89
160 0.88
161 0.87
162 0.86
163 0.83
164 0.77
165 0.7
166 0.61
167 0.58
168 0.52
169 0.48
170 0.5
171 0.46
172 0.43