Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135UQU2

Protein Details
Accession A0A135UQU2    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
186-228KSLNSLRKEKKRGVEQYRRPELVQRRVRRRRLGQYGRRQVFRAHydrophilic
NLS Segment(s)
PositionSequence
192-218RKEKKRGVEQYRRPELVQRRVRRRRLG
Subcellular Location(s) pero 10, mito 7, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MDTTPLGVKMDPATLDTVLIWGFGRSDGVGPSPFTKARGESHLVLVDEAVNLNKGKFMRQQKPNVVPVVHTVNSYRTIFREVFGVFEYLRWSPPSGTGGSGPFPVVEPVWNKWMRVSNWFDLVLWEFDNQYAGRWNERAGAPVNSLGSPSLRALYARFIEDYLLGIEETAALKSSEAKTAYEAKFKSLNSLRKEKKRGVEQYRRPELVQRRVRRRRLGQYGRRQVFRARDGVAVNIGAPARI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.13
4 0.13
5 0.1
6 0.1
7 0.09
8 0.07
9 0.07
10 0.07
11 0.08
12 0.07
13 0.08
14 0.09
15 0.11
16 0.12
17 0.14
18 0.15
19 0.19
20 0.19
21 0.2
22 0.22
23 0.23
24 0.25
25 0.29
26 0.32
27 0.3
28 0.33
29 0.34
30 0.32
31 0.29
32 0.25
33 0.19
34 0.15
35 0.13
36 0.1
37 0.08
38 0.08
39 0.08
40 0.11
41 0.11
42 0.14
43 0.22
44 0.32
45 0.4
46 0.48
47 0.57
48 0.63
49 0.7
50 0.71
51 0.67
52 0.58
53 0.49
54 0.44
55 0.41
56 0.32
57 0.26
58 0.22
59 0.2
60 0.24
61 0.24
62 0.21
63 0.16
64 0.2
65 0.19
66 0.19
67 0.2
68 0.15
69 0.15
70 0.15
71 0.15
72 0.11
73 0.11
74 0.13
75 0.1
76 0.12
77 0.11
78 0.12
79 0.11
80 0.13
81 0.14
82 0.13
83 0.13
84 0.13
85 0.13
86 0.13
87 0.13
88 0.11
89 0.09
90 0.09
91 0.08
92 0.07
93 0.08
94 0.09
95 0.11
96 0.17
97 0.18
98 0.18
99 0.2
100 0.25
101 0.24
102 0.28
103 0.32
104 0.26
105 0.28
106 0.28
107 0.26
108 0.21
109 0.21
110 0.15
111 0.11
112 0.09
113 0.07
114 0.07
115 0.08
116 0.08
117 0.07
118 0.11
119 0.11
120 0.12
121 0.12
122 0.13
123 0.15
124 0.15
125 0.17
126 0.15
127 0.15
128 0.15
129 0.15
130 0.16
131 0.12
132 0.12
133 0.11
134 0.09
135 0.09
136 0.08
137 0.08
138 0.07
139 0.07
140 0.08
141 0.12
142 0.12
143 0.12
144 0.12
145 0.12
146 0.12
147 0.12
148 0.12
149 0.08
150 0.08
151 0.06
152 0.06
153 0.05
154 0.05
155 0.06
156 0.05
157 0.05
158 0.05
159 0.05
160 0.09
161 0.1
162 0.14
163 0.15
164 0.15
165 0.17
166 0.26
167 0.28
168 0.31
169 0.31
170 0.3
171 0.34
172 0.33
173 0.39
174 0.39
175 0.45
176 0.44
177 0.55
178 0.6
179 0.66
180 0.73
181 0.71
182 0.72
183 0.75
184 0.79
185 0.79
186 0.81
187 0.81
188 0.85
189 0.86
190 0.8
191 0.7
192 0.69
193 0.67
194 0.67
195 0.67
196 0.67
197 0.69
198 0.77
199 0.85
200 0.87
201 0.87
202 0.87
203 0.88
204 0.89
205 0.88
206 0.89
207 0.91
208 0.88
209 0.82
210 0.74
211 0.7
212 0.67
213 0.62
214 0.55
215 0.47
216 0.44
217 0.42
218 0.41
219 0.36
220 0.27
221 0.22
222 0.2