Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3JD98

Protein Details
Accession G3JD98    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MGKRKSSRKPMGPKRADPLPBasic
NLS Segment(s)
PositionSequence
3-14KRKSSRKPMGPK
Subcellular Location(s) mito 22, cyto 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
GO:0003746  F:translation elongation factor activity  
KEGG cmt:CCM_03946  -  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKSSRKPMGPKRADPLPTTFTCLFCNHEKSVTVKLDRKAGVGQLDCRICGQKFQCAVNYLSAAVDVYGEWVDAAEAVAKEDSARAGYTGTAGATPSRRDREVEDATSDREESRRYGGEGIGADDEDD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.72
4 0.63
5 0.58
6 0.53
7 0.45
8 0.46
9 0.41
10 0.34
11 0.33
12 0.32
13 0.3
14 0.29
15 0.33
16 0.28
17 0.29
18 0.29
19 0.29
20 0.35
21 0.36
22 0.37
23 0.37
24 0.38
25 0.42
26 0.41
27 0.39
28 0.33
29 0.3
30 0.29
31 0.25
32 0.25
33 0.24
34 0.24
35 0.22
36 0.22
37 0.22
38 0.17
39 0.21
40 0.2
41 0.21
42 0.23
43 0.24
44 0.26
45 0.25
46 0.26
47 0.22
48 0.21
49 0.15
50 0.12
51 0.11
52 0.08
53 0.06
54 0.05
55 0.03
56 0.04
57 0.03
58 0.03
59 0.03
60 0.03
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.05
67 0.05
68 0.05
69 0.05
70 0.05
71 0.06
72 0.05
73 0.06
74 0.05
75 0.06
76 0.06
77 0.06
78 0.07
79 0.06
80 0.06
81 0.06
82 0.08
83 0.1
84 0.13
85 0.19
86 0.23
87 0.24
88 0.26
89 0.29
90 0.36
91 0.39
92 0.38
93 0.38
94 0.35
95 0.36
96 0.36
97 0.33
98 0.26
99 0.22
100 0.22
101 0.19
102 0.22
103 0.22
104 0.23
105 0.24
106 0.23
107 0.25
108 0.24
109 0.24
110 0.2