Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

G3J860

Protein Details
Accession G3J860   
Localization Confidence Low
Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
69-96GARTTHQQVNRRRHRQLRSSRRLRIYQFHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, nucl 11, cyto 7, mito 5, extr 4
Family & Domain DBs
KEGG cmt:CCM_02172  -  
Amino Acid Sequences MIILPNPQCLTAASSRRDGLFLPLTSTALRAPQDDTGDIDDAGDTGDTGDTGDTGDMGDTIGVIIADSGARTTHQQVNRRRHRQLRSSRRLRIYQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.34
3 0.34
4 0.33
5 0.29
6 0.27
7 0.25
8 0.23
9 0.22
10 0.21
11 0.21
12 0.21
13 0.21
14 0.16
15 0.13
16 0.14
17 0.12
18 0.13
19 0.15
20 0.16
21 0.15
22 0.16
23 0.15
24 0.15
25 0.14
26 0.12
27 0.09
28 0.07
29 0.07
30 0.05
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.03
37 0.03
38 0.03
39 0.03
40 0.03
41 0.03
42 0.03
43 0.03
44 0.03
45 0.03
46 0.02
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.03
54 0.03
55 0.03
56 0.03
57 0.04
58 0.07
59 0.11
60 0.19
61 0.25
62 0.34
63 0.43
64 0.54
65 0.64
66 0.71
67 0.76
68 0.78
69 0.82
70 0.84
71 0.86
72 0.87
73 0.87
74 0.88
75 0.88
76 0.87