Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135V807

Protein Details
Accession A0A135V807    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
50-104NSFDELKRLKRRKVDTPQHRPPPERRHARRPSPADAHGVARRHHHRRPNQNDAVEBasic
NLS Segment(s)
PositionSequence
56-96KRLKRRKVDTPQHRPPPERRHARRPSPADAHGVARRHHHRR
Subcellular Location(s) extr 15, cyto 5, plas 3, mito 2, pero 2
Family & Domain DBs
Amino Acid Sequences MRGTDASFLVLSGLAVLASAREVQVDDVPVECATICGPIVELTFKCDVDNSFDELKRLKRRKVDTPQHRPPPERRHARRPSPADAHGVARRHHHRRPNQNDAVEVSTPGLDQPQATNVVQQPPQDAQQPAQDAQQSAVDATPVFIATLPFAAPSPEIPLSTSTPDAQNTPTPSAPAPPPQATPSIDPPPQVPPPVPVLITSTVFLTVSAPTIPTPLPPPVLPPVQAPPPVQAPPPVQAPPPVQAPPPVQAPPPVQPPPVITAPRPQQPPSLPPPSSTSRPMPQQPPAQQPPLEQQPPPQQQPQRPPPPQQQPPPSSSPQTTPPMLRPTPPQQLQPPQASMSNPTAIPIMGPGPEKQPDNKSPNDREEAEKQCTCSNKSFDVQLLAGLCQSCIRKTGNRANNLDFIMKECNFVESTYTPDKDRLVDNIRVVAEKPFLTSSGNVMADAGRAGAGCAAAAAVVISLVAGMAVLL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.04
4 0.04
5 0.05
6 0.06
7 0.05
8 0.06
9 0.07
10 0.09
11 0.12
12 0.13
13 0.13
14 0.13
15 0.14
16 0.14
17 0.13
18 0.11
19 0.09
20 0.08
21 0.09
22 0.08
23 0.07
24 0.07
25 0.08
26 0.1
27 0.13
28 0.13
29 0.16
30 0.19
31 0.19
32 0.19
33 0.19
34 0.19
35 0.23
36 0.25
37 0.26
38 0.3
39 0.31
40 0.33
41 0.35
42 0.43
43 0.47
44 0.52
45 0.54
46 0.57
47 0.64
48 0.72
49 0.79
50 0.82
51 0.82
52 0.85
53 0.88
54 0.89
55 0.89
56 0.85
57 0.84
58 0.83
59 0.83
60 0.83
61 0.81
62 0.81
63 0.85
64 0.88
65 0.89
66 0.84
67 0.82
68 0.78
69 0.73
70 0.67
71 0.59
72 0.54
73 0.49
74 0.46
75 0.39
76 0.41
77 0.47
78 0.49
79 0.55
80 0.59
81 0.64
82 0.71
83 0.79
84 0.81
85 0.8
86 0.74
87 0.68
88 0.62
89 0.56
90 0.45
91 0.36
92 0.26
93 0.18
94 0.16
95 0.14
96 0.12
97 0.08
98 0.08
99 0.08
100 0.1
101 0.14
102 0.14
103 0.17
104 0.19
105 0.24
106 0.26
107 0.26
108 0.26
109 0.24
110 0.26
111 0.27
112 0.25
113 0.22
114 0.24
115 0.27
116 0.25
117 0.26
118 0.26
119 0.21
120 0.21
121 0.21
122 0.16
123 0.13
124 0.12
125 0.1
126 0.08
127 0.08
128 0.07
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.06
136 0.06
137 0.06
138 0.06
139 0.06
140 0.06
141 0.1
142 0.11
143 0.11
144 0.11
145 0.14
146 0.15
147 0.17
148 0.18
149 0.14
150 0.15
151 0.16
152 0.16
153 0.16
154 0.18
155 0.19
156 0.21
157 0.2
158 0.2
159 0.19
160 0.21
161 0.21
162 0.23
163 0.24
164 0.23
165 0.24
166 0.24
167 0.27
168 0.26
169 0.27
170 0.27
171 0.28
172 0.27
173 0.26
174 0.26
175 0.28
176 0.27
177 0.26
178 0.21
179 0.17
180 0.2
181 0.21
182 0.19
183 0.15
184 0.16
185 0.16
186 0.16
187 0.14
188 0.11
189 0.1
190 0.1
191 0.09
192 0.07
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.07
199 0.07
200 0.07
201 0.09
202 0.1
203 0.11
204 0.11
205 0.13
206 0.15
207 0.16
208 0.16
209 0.15
210 0.17
211 0.19
212 0.21
213 0.2
214 0.18
215 0.19
216 0.2
217 0.19
218 0.2
219 0.18
220 0.17
221 0.19
222 0.19
223 0.16
224 0.19
225 0.2
226 0.18
227 0.2
228 0.19
229 0.16
230 0.19
231 0.2
232 0.18
233 0.2
234 0.19
235 0.16
236 0.19
237 0.21
238 0.2
239 0.25
240 0.25
241 0.23
242 0.22
243 0.23
244 0.24
245 0.26
246 0.24
247 0.19
248 0.24
249 0.28
250 0.33
251 0.34
252 0.32
253 0.32
254 0.33
255 0.38
256 0.38
257 0.41
258 0.36
259 0.34
260 0.38
261 0.38
262 0.39
263 0.37
264 0.35
265 0.31
266 0.36
267 0.4
268 0.4
269 0.41
270 0.46
271 0.48
272 0.52
273 0.53
274 0.51
275 0.47
276 0.44
277 0.43
278 0.44
279 0.4
280 0.31
281 0.33
282 0.39
283 0.44
284 0.46
285 0.48
286 0.46
287 0.51
288 0.6
289 0.65
290 0.65
291 0.64
292 0.68
293 0.7
294 0.74
295 0.76
296 0.74
297 0.74
298 0.68
299 0.68
300 0.67
301 0.61
302 0.54
303 0.48
304 0.42
305 0.38
306 0.38
307 0.36
308 0.32
309 0.33
310 0.37
311 0.36
312 0.36
313 0.36
314 0.39
315 0.46
316 0.46
317 0.46
318 0.45
319 0.53
320 0.56
321 0.54
322 0.48
323 0.41
324 0.4
325 0.36
326 0.33
327 0.28
328 0.24
329 0.2
330 0.19
331 0.17
332 0.15
333 0.14
334 0.11
335 0.09
336 0.09
337 0.1
338 0.11
339 0.14
340 0.17
341 0.19
342 0.23
343 0.3
344 0.37
345 0.41
346 0.48
347 0.53
348 0.56
349 0.61
350 0.62
351 0.56
352 0.53
353 0.56
354 0.55
355 0.53
356 0.48
357 0.44
358 0.43
359 0.45
360 0.44
361 0.42
362 0.4
363 0.37
364 0.37
365 0.38
366 0.35
367 0.34
368 0.3
369 0.25
370 0.22
371 0.17
372 0.17
373 0.14
374 0.13
375 0.13
376 0.14
377 0.13
378 0.16
379 0.19
380 0.24
381 0.33
382 0.43
383 0.48
384 0.56
385 0.6
386 0.61
387 0.62
388 0.58
389 0.51
390 0.41
391 0.35
392 0.34
393 0.29
394 0.26
395 0.22
396 0.22
397 0.21
398 0.21
399 0.23
400 0.16
401 0.23
402 0.27
403 0.29
404 0.28
405 0.3
406 0.31
407 0.29
408 0.31
409 0.32
410 0.32
411 0.36
412 0.36
413 0.38
414 0.38
415 0.36
416 0.35
417 0.3
418 0.27
419 0.22
420 0.23
421 0.19
422 0.19
423 0.2
424 0.2
425 0.2
426 0.23
427 0.23
428 0.2
429 0.2
430 0.19
431 0.17
432 0.16
433 0.13
434 0.07
435 0.06
436 0.06
437 0.07
438 0.06
439 0.05
440 0.05
441 0.05
442 0.04
443 0.04
444 0.04
445 0.03
446 0.03
447 0.03
448 0.02
449 0.02
450 0.02
451 0.02