Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135V6I7

Protein Details
Accession A0A135V6I7   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
43-63GTFPEDKKKKAVRKVDYRLMPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 24, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR011701  MFS  
IPR036259  MFS_trans_sf  
Gene Ontology GO:0016020  C:membrane  
GO:0022857  F:transmembrane transporter activity  
Pfam View protein in Pfam  
PF07690  MFS_1  
Amino Acid Sequences MAVNRVSLDRSDIEHVSHEKDSVAHDEYQRHGNLSPEDVAFLGTFPEDKKKKAVRKVDYRLMPMLILLYHMAYLDKTNIGNAKIEGPLVGWISQEVDQAAGAAGTSHCLRYPQSHIILEGLATVVIGAMCFFFLIDSPTLSKWLDDDQKRYLELRQEARRVHRPSEFGEKHFDKQALIFVLTDWKIYLLIFANWSNAVPNYAMKFTMPQIIKNMGYTLANAQLLTMPPYAVGAISAYVFSVFADRYSWRMPFIIGPQLCLVAAFSILFTESADIKDNIALCYFAICLACFG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.28
3 0.29
4 0.28
5 0.25
6 0.21
7 0.21
8 0.23
9 0.23
10 0.24
11 0.23
12 0.26
13 0.29
14 0.32
15 0.37
16 0.35
17 0.32
18 0.29
19 0.3
20 0.28
21 0.28
22 0.28
23 0.21
24 0.21
25 0.19
26 0.19
27 0.14
28 0.12
29 0.09
30 0.07
31 0.08
32 0.09
33 0.19
34 0.2
35 0.22
36 0.32
37 0.4
38 0.49
39 0.58
40 0.67
41 0.67
42 0.76
43 0.83
44 0.83
45 0.79
46 0.74
47 0.66
48 0.57
49 0.46
50 0.35
51 0.27
52 0.17
53 0.13
54 0.09
55 0.07
56 0.06
57 0.06
58 0.06
59 0.06
60 0.07
61 0.07
62 0.09
63 0.08
64 0.11
65 0.13
66 0.14
67 0.15
68 0.14
69 0.15
70 0.14
71 0.14
72 0.12
73 0.1
74 0.11
75 0.1
76 0.1
77 0.08
78 0.07
79 0.09
80 0.1
81 0.1
82 0.08
83 0.07
84 0.07
85 0.07
86 0.06
87 0.04
88 0.04
89 0.04
90 0.03
91 0.05
92 0.05
93 0.06
94 0.06
95 0.07
96 0.08
97 0.12
98 0.17
99 0.21
100 0.24
101 0.25
102 0.25
103 0.24
104 0.23
105 0.19
106 0.14
107 0.08
108 0.05
109 0.04
110 0.03
111 0.03
112 0.02
113 0.02
114 0.02
115 0.02
116 0.02
117 0.02
118 0.02
119 0.02
120 0.02
121 0.04
122 0.05
123 0.05
124 0.06
125 0.07
126 0.09
127 0.09
128 0.08
129 0.08
130 0.12
131 0.19
132 0.2
133 0.23
134 0.25
135 0.26
136 0.27
137 0.27
138 0.25
139 0.23
140 0.26
141 0.3
142 0.33
143 0.37
144 0.39
145 0.44
146 0.51
147 0.48
148 0.47
149 0.43
150 0.4
151 0.38
152 0.46
153 0.43
154 0.35
155 0.4
156 0.39
157 0.37
158 0.38
159 0.35
160 0.24
161 0.23
162 0.24
163 0.17
164 0.15
165 0.13
166 0.1
167 0.14
168 0.14
169 0.14
170 0.1
171 0.09
172 0.09
173 0.09
174 0.1
175 0.07
176 0.07
177 0.09
178 0.1
179 0.1
180 0.1
181 0.11
182 0.1
183 0.09
184 0.1
185 0.08
186 0.1
187 0.11
188 0.11
189 0.12
190 0.11
191 0.12
192 0.12
193 0.2
194 0.18
195 0.18
196 0.21
197 0.25
198 0.25
199 0.24
200 0.23
201 0.17
202 0.16
203 0.16
204 0.14
205 0.13
206 0.13
207 0.12
208 0.12
209 0.12
210 0.12
211 0.14
212 0.13
213 0.09
214 0.09
215 0.09
216 0.09
217 0.07
218 0.07
219 0.05
220 0.05
221 0.05
222 0.05
223 0.05
224 0.05
225 0.05
226 0.05
227 0.06
228 0.06
229 0.06
230 0.09
231 0.09
232 0.13
233 0.17
234 0.18
235 0.17
236 0.18
237 0.19
238 0.2
239 0.23
240 0.29
241 0.26
242 0.27
243 0.26
244 0.26
245 0.25
246 0.21
247 0.18
248 0.08
249 0.09
250 0.07
251 0.06
252 0.06
253 0.06
254 0.06
255 0.06
256 0.08
257 0.08
258 0.1
259 0.14
260 0.14
261 0.14
262 0.16
263 0.17
264 0.17
265 0.16
266 0.15
267 0.11
268 0.12
269 0.11
270 0.11
271 0.11