Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135V835

Protein Details
Accession A0A135V835    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
215-235AKPPKAKKIKATKELEKGKSKBasic
237-259QEFNTKSKFGKHKKDSMFRTPDGHydrophilic
NLS Segment(s)
PositionSequence
214-250AAKPPKAKKIKATKELEKGKSKWQEFNTKSKFGKHKK
Subcellular Location(s) nucl 17.5, mito_nucl 9.5, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR002999  Tudor  
IPR043560  ZGPAT  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
GO:0045892  P:negative regulation of DNA-templated transcription  
CDD cd20446  Tudor_SpSPF30-like  
Amino Acid Sequences MSGQIAALEEDRKQYQEQLDVVLAGLKDDPENAELKNLQAELNDMVSLLNESLAELQPKQAPKPVPQKAPSPPEPEKWSKENHPAFKKAAPAPEEKEEPPVTYQVNDTVSAKWASGDRGFYPARITSITGSSTDPVYIVKFKSYDNTETLRAKDIRPISNKRKADGASAPASNTTQPTARPPGPSNGVVTSAAASLYPEQQAKIEAEKNAADGAAKPPKAKKIKATKELEKGKSKWQEFNTKSKFGKHKKDSMFRTPDGVGGRVGFTGSGQAMRKDTARSRHVYQQNDELD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.27
3 0.31
4 0.31
5 0.29
6 0.28
7 0.26
8 0.25
9 0.22
10 0.18
11 0.13
12 0.12
13 0.1
14 0.09
15 0.1
16 0.11
17 0.1
18 0.12
19 0.11
20 0.15
21 0.15
22 0.16
23 0.18
24 0.17
25 0.16
26 0.14
27 0.16
28 0.13
29 0.14
30 0.13
31 0.1
32 0.09
33 0.09
34 0.09
35 0.07
36 0.06
37 0.05
38 0.05
39 0.08
40 0.09
41 0.11
42 0.1
43 0.13
44 0.17
45 0.19
46 0.21
47 0.25
48 0.27
49 0.34
50 0.44
51 0.5
52 0.54
53 0.55
54 0.61
55 0.63
56 0.68
57 0.65
58 0.63
59 0.59
60 0.57
61 0.6
62 0.6
63 0.57
64 0.52
65 0.52
66 0.49
67 0.56
68 0.58
69 0.6
70 0.6
71 0.59
72 0.58
73 0.55
74 0.56
75 0.49
76 0.46
77 0.4
78 0.39
79 0.38
80 0.4
81 0.41
82 0.34
83 0.37
84 0.31
85 0.29
86 0.26
87 0.24
88 0.2
89 0.17
90 0.17
91 0.15
92 0.15
93 0.15
94 0.15
95 0.13
96 0.15
97 0.14
98 0.14
99 0.11
100 0.11
101 0.12
102 0.12
103 0.14
104 0.12
105 0.17
106 0.17
107 0.17
108 0.18
109 0.16
110 0.15
111 0.14
112 0.14
113 0.1
114 0.12
115 0.12
116 0.11
117 0.11
118 0.11
119 0.1
120 0.09
121 0.08
122 0.07
123 0.08
124 0.08
125 0.08
126 0.09
127 0.1
128 0.1
129 0.14
130 0.16
131 0.18
132 0.19
133 0.21
134 0.23
135 0.24
136 0.25
137 0.26
138 0.24
139 0.22
140 0.25
141 0.27
142 0.29
143 0.35
144 0.43
145 0.46
146 0.54
147 0.55
148 0.51
149 0.51
150 0.46
151 0.43
152 0.38
153 0.34
154 0.28
155 0.27
156 0.26
157 0.22
158 0.21
159 0.17
160 0.15
161 0.11
162 0.09
163 0.1
164 0.14
165 0.19
166 0.21
167 0.24
168 0.26
169 0.29
170 0.32
171 0.32
172 0.3
173 0.25
174 0.24
175 0.21
176 0.19
177 0.15
178 0.11
179 0.1
180 0.07
181 0.07
182 0.06
183 0.08
184 0.09
185 0.09
186 0.09
187 0.1
188 0.12
189 0.13
190 0.16
191 0.18
192 0.17
193 0.19
194 0.18
195 0.19
196 0.17
197 0.16
198 0.12
199 0.1
200 0.16
201 0.2
202 0.21
203 0.23
204 0.27
205 0.36
206 0.43
207 0.46
208 0.5
209 0.54
210 0.63
211 0.71
212 0.75
213 0.75
214 0.77
215 0.83
216 0.8
217 0.78
218 0.7
219 0.7
220 0.71
221 0.66
222 0.64
223 0.61
224 0.64
225 0.6
226 0.69
227 0.66
228 0.65
229 0.63
230 0.64
231 0.68
232 0.67
233 0.74
234 0.71
235 0.74
236 0.76
237 0.84
238 0.82
239 0.82
240 0.8
241 0.71
242 0.67
243 0.57
244 0.52
245 0.45
246 0.38
247 0.29
248 0.22
249 0.21
250 0.16
251 0.16
252 0.11
253 0.09
254 0.1
255 0.1
256 0.14
257 0.15
258 0.17
259 0.19
260 0.21
261 0.24
262 0.28
263 0.34
264 0.38
265 0.44
266 0.47
267 0.51
268 0.59
269 0.64
270 0.65
271 0.63