Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135T8I1

Protein Details
Accession A0A135T8I1    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
37-64GTRKSTAKITKKKQSKKAPPRGSARNFPHydrophilic
NLS Segment(s)
PositionSequence
25-59AAIKKGGRLTQSGTRKSTAKITKKKQSKKAPPRGS
Subcellular Location(s) mito 12, nucl 10.5, cyto_nucl 6.5, extr 3
Family & Domain DBs
Amino Acid Sequences MPGSDRAVVAEALDAVGGSSRSRNAAIKKGGRLTQSGTRKSTAKITKKKQSKKAPPRGSARNFPYRQCVTRATKAPGHNVDTGAAC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.06
2 0.04
3 0.05
4 0.05
5 0.05
6 0.06
7 0.07
8 0.09
9 0.11
10 0.16
11 0.19
12 0.26
13 0.33
14 0.37
15 0.41
16 0.44
17 0.45
18 0.42
19 0.4
20 0.36
21 0.37
22 0.4
23 0.4
24 0.37
25 0.36
26 0.36
27 0.35
28 0.4
29 0.4
30 0.42
31 0.47
32 0.54
33 0.61
34 0.7
35 0.78
36 0.79
37 0.81
38 0.83
39 0.85
40 0.88
41 0.88
42 0.86
43 0.85
44 0.85
45 0.8
46 0.78
47 0.73
48 0.73
49 0.65
50 0.6
51 0.6
52 0.56
53 0.52
54 0.47
55 0.49
56 0.46
57 0.52
58 0.56
59 0.53
60 0.54
61 0.56
62 0.6
63 0.58
64 0.55
65 0.49
66 0.44