Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A135V398

Protein Details
Accession A0A135V398   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
109-128ATARRLAKSRSRRPRSVGAPHydrophilic
NLS Segment(s)
PositionSequence
115-122AKSRSRRP
Subcellular Location(s) nucl 13, cyto 6, mito 4, extr 3, cyto_pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR043129  ATPase_NBD  
Amino Acid Sequences MVRTRISEEDEKAIIIGIDFGTTFSGVSWAYSGQPDNIEVISRWESKINLNSEKEKVPSSILFQGKRGNTSWGYAIPNDGKQEPLKWFKLLLVDERDLPDNIRDSSQIATARRLAKSRSRRPRSVGAPPFTD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.12
3 0.11
4 0.06
5 0.06
6 0.05
7 0.06
8 0.06
9 0.06
10 0.06
11 0.05
12 0.07
13 0.06
14 0.07
15 0.07
16 0.07
17 0.08
18 0.09
19 0.1
20 0.1
21 0.11
22 0.11
23 0.11
24 0.11
25 0.11
26 0.09
27 0.13
28 0.15
29 0.16
30 0.16
31 0.16
32 0.17
33 0.2
34 0.26
35 0.27
36 0.29
37 0.31
38 0.34
39 0.34
40 0.35
41 0.33
42 0.28
43 0.24
44 0.2
45 0.18
46 0.18
47 0.22
48 0.25
49 0.24
50 0.24
51 0.28
52 0.27
53 0.28
54 0.26
55 0.22
56 0.18
57 0.19
58 0.18
59 0.16
60 0.17
61 0.15
62 0.16
63 0.14
64 0.15
65 0.16
66 0.15
67 0.15
68 0.15
69 0.18
70 0.21
71 0.25
72 0.26
73 0.24
74 0.25
75 0.24
76 0.28
77 0.27
78 0.26
79 0.26
80 0.25
81 0.25
82 0.26
83 0.27
84 0.22
85 0.22
86 0.19
87 0.17
88 0.17
89 0.16
90 0.15
91 0.15
92 0.16
93 0.19
94 0.21
95 0.2
96 0.22
97 0.27
98 0.31
99 0.33
100 0.35
101 0.36
102 0.42
103 0.51
104 0.59
105 0.65
106 0.69
107 0.73
108 0.76
109 0.81
110 0.79
111 0.79
112 0.78