Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A135SGN9

Protein Details
Accession A0A135SGN9    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-57DETKVRAQPRPHPRPRRHRPTARGIERBasic
NLS Segment(s)
PositionSequence
25-57RRRRHPDETKVRAQPRPHPRPRRHRPTARGIER
Subcellular Location(s) cyto 11, mito 9, cyto_nucl 9, nucl 5
Family & Domain DBs
Amino Acid Sequences MSSRRHCAGVGVDTGTGIGIGVVGRRRRHPDETKVRAQPRPHPRPRRHRPTARGIERLPPAAFLRIHHRRENFHLGEHVVEGILVRGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.16
3 0.11
4 0.07
5 0.04
6 0.03
7 0.03
8 0.05
9 0.1
10 0.15
11 0.18
12 0.23
13 0.3
14 0.36
15 0.44
16 0.5
17 0.56
18 0.62
19 0.67
20 0.71
21 0.72
22 0.71
23 0.68
24 0.63
25 0.62
26 0.62
27 0.66
28 0.68
29 0.7
30 0.75
31 0.81
32 0.88
33 0.89
34 0.88
35 0.87
36 0.83
37 0.84
38 0.85
39 0.8
40 0.75
41 0.66
42 0.62
43 0.55
44 0.51
45 0.4
46 0.32
47 0.27
48 0.25
49 0.24
50 0.19
51 0.27
52 0.33
53 0.38
54 0.42
55 0.44
56 0.46
57 0.53
58 0.61
59 0.52
60 0.46
61 0.44
62 0.39
63 0.36
64 0.32
65 0.25
66 0.15
67 0.13
68 0.1