Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

G3J5W4

Protein Details
Accession G3J5W4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-98YPLPNSQRPRKDRTPIQRARSTEHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 23, mito 1, plas 1, pero 1, golg 1
Family & Domain DBs
KEGG cmt:CCM_01574  -  
Amino Acid Sequences MLVKLSTLAAAILLLVSATKANDAGLQNSSLKRPPTNNFNCIRPGPQVQDPSRGACCLNIVRRQGKECKPLNLSVYPLPNSQRPRKDRTPIQRARSTEWRDAVTR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.04
5 0.04
6 0.05
7 0.05
8 0.05
9 0.1
10 0.11
11 0.13
12 0.13
13 0.15
14 0.18
15 0.19
16 0.21
17 0.21
18 0.22
19 0.23
20 0.27
21 0.3
22 0.38
23 0.43
24 0.48
25 0.47
26 0.47
27 0.48
28 0.44
29 0.42
30 0.35
31 0.31
32 0.28
33 0.3
34 0.34
35 0.31
36 0.37
37 0.35
38 0.34
39 0.32
40 0.28
41 0.23
42 0.16
43 0.18
44 0.15
45 0.19
46 0.22
47 0.26
48 0.3
49 0.32
50 0.36
51 0.42
52 0.44
53 0.49
54 0.48
55 0.49
56 0.48
57 0.49
58 0.49
59 0.42
60 0.39
61 0.34
62 0.34
63 0.3
64 0.29
65 0.29
66 0.31
67 0.37
68 0.43
69 0.49
70 0.51
71 0.57
72 0.64
73 0.71
74 0.75
75 0.78
76 0.81
77 0.8
78 0.83
79 0.81
80 0.77
81 0.75
82 0.75
83 0.71
84 0.67
85 0.62